Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067QL14

Protein Details
Accession A0A067QL14    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
79-99RTCRRTCRETCGQPRQTRIRGHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 15, mito 6, cyto 3, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013632  DNA_recomb/repair_Rad51_C  
IPR020587  RecA_monomer-monomer_interface  
Gene Ontology GO:0005524  F:ATP binding  
GO:0008094  F:ATP-dependent activity, acting on DNA  
GO:0003677  F:DNA binding  
GO:0006259  P:DNA metabolic process  
Pfam View protein in Pfam  
PF08423  Rad51  
PROSITE View protein in PROSITE  
PS50163  RECA_3  
Amino Acid Sequences MTFVAGGALKPIGGHILSHASATRMFLRKGEPSRQSDSIPSPSNPPILDEPIPMVVGNICAHPLSALPPPSFFRFLVARTCRRTCRETCGQPRQTRIRGVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.12
4 0.12
5 0.13
6 0.13
7 0.13
8 0.13
9 0.15
10 0.2
11 0.19
12 0.19
13 0.2
14 0.24
15 0.3
16 0.35
17 0.41
18 0.42
19 0.43
20 0.49
21 0.5
22 0.47
23 0.43
24 0.41
25 0.38
26 0.35
27 0.3
28 0.28
29 0.27
30 0.28
31 0.24
32 0.22
33 0.19
34 0.19
35 0.19
36 0.15
37 0.15
38 0.13
39 0.13
40 0.11
41 0.09
42 0.05
43 0.06
44 0.06
45 0.06
46 0.06
47 0.05
48 0.05
49 0.06
50 0.06
51 0.07
52 0.1
53 0.13
54 0.13
55 0.15
56 0.18
57 0.22
58 0.24
59 0.22
60 0.21
61 0.21
62 0.22
63 0.3
64 0.34
65 0.38
66 0.42
67 0.48
68 0.52
69 0.55
70 0.59
71 0.53
72 0.56
73 0.59
74 0.63
75 0.68
76 0.72
77 0.77
78 0.76
79 0.82
80 0.82
81 0.77