Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A066XT28

Protein Details
Accession A0A066XT28    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
255-280VLFNPRMTGKKPKKGRKYGVENLGSVHydrophilic
NLS Segment(s)
PositionSequence
263-271GKKPKKGRK
Subcellular Location(s) nucl 8cyto 8cyto_nucl 8, mito 4, extr 4
Family & Domain DBs
Amino Acid Sequences MKDSSAQPTTYDDDEPLATFDVLLSDVVIGEDSTLRTLNVSIDDWERRNVIERTQGNIHTRVELMDVVHGTYDDEGDEATLMVFRFRFDPQKNTRRVIRARVNIEFLPSDDESSAPIVDAIAPEQRWTVSRTIDQTSTTTGGEVNVGAAGVPFLEAGVTGKMEKTVSRDVSGATTITGSINLGTGRNFGDSTVAVWNLQENRQRKGGIPDSVSAAVLLRREDNAPFTARVTLDVDVDARSGLERKFMKVPLDDPVLFNPRMTGKKPKKGRKYGVENLGSVNLYQLCLVRMEGSAYSWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.18
4 0.16
5 0.13
6 0.12
7 0.11
8 0.1
9 0.09
10 0.09
11 0.07
12 0.05
13 0.05
14 0.06
15 0.06
16 0.05
17 0.05
18 0.06
19 0.07
20 0.08
21 0.08
22 0.08
23 0.09
24 0.09
25 0.1
26 0.11
27 0.12
28 0.13
29 0.18
30 0.23
31 0.24
32 0.25
33 0.25
34 0.23
35 0.28
36 0.27
37 0.26
38 0.31
39 0.31
40 0.34
41 0.39
42 0.43
43 0.41
44 0.43
45 0.4
46 0.32
47 0.31
48 0.26
49 0.22
50 0.18
51 0.14
52 0.13
53 0.12
54 0.1
55 0.1
56 0.1
57 0.08
58 0.08
59 0.07
60 0.05
61 0.05
62 0.04
63 0.04
64 0.05
65 0.04
66 0.04
67 0.05
68 0.05
69 0.06
70 0.06
71 0.07
72 0.09
73 0.11
74 0.2
75 0.22
76 0.32
77 0.41
78 0.5
79 0.55
80 0.58
81 0.61
82 0.61
83 0.63
84 0.63
85 0.62
86 0.61
87 0.61
88 0.58
89 0.56
90 0.48
91 0.45
92 0.35
93 0.27
94 0.23
95 0.18
96 0.16
97 0.12
98 0.12
99 0.11
100 0.11
101 0.11
102 0.06
103 0.06
104 0.05
105 0.05
106 0.05
107 0.05
108 0.07
109 0.07
110 0.07
111 0.08
112 0.08
113 0.09
114 0.11
115 0.12
116 0.12
117 0.14
118 0.17
119 0.19
120 0.2
121 0.2
122 0.18
123 0.18
124 0.17
125 0.15
126 0.12
127 0.1
128 0.09
129 0.08
130 0.07
131 0.05
132 0.04
133 0.03
134 0.03
135 0.03
136 0.02
137 0.02
138 0.02
139 0.02
140 0.02
141 0.02
142 0.02
143 0.03
144 0.03
145 0.04
146 0.04
147 0.04
148 0.05
149 0.06
150 0.06
151 0.1
152 0.15
153 0.16
154 0.17
155 0.17
156 0.17
157 0.18
158 0.18
159 0.14
160 0.08
161 0.07
162 0.07
163 0.06
164 0.06
165 0.05
166 0.04
167 0.05
168 0.05
169 0.06
170 0.06
171 0.07
172 0.07
173 0.08
174 0.08
175 0.07
176 0.08
177 0.08
178 0.09
179 0.1
180 0.1
181 0.09
182 0.09
183 0.11
184 0.12
185 0.17
186 0.22
187 0.23
188 0.25
189 0.29
190 0.3
191 0.29
192 0.36
193 0.38
194 0.36
195 0.36
196 0.34
197 0.33
198 0.33
199 0.31
200 0.22
201 0.17
202 0.13
203 0.12
204 0.12
205 0.09
206 0.1
207 0.11
208 0.12
209 0.14
210 0.16
211 0.17
212 0.17
213 0.18
214 0.19
215 0.18
216 0.19
217 0.19
218 0.17
219 0.15
220 0.14
221 0.14
222 0.11
223 0.11
224 0.09
225 0.07
226 0.07
227 0.1
228 0.09
229 0.16
230 0.17
231 0.21
232 0.26
233 0.29
234 0.32
235 0.32
236 0.33
237 0.32
238 0.37
239 0.34
240 0.31
241 0.33
242 0.35
243 0.32
244 0.31
245 0.27
246 0.27
247 0.31
248 0.34
249 0.39
250 0.44
251 0.54
252 0.65
253 0.73
254 0.78
255 0.84
256 0.9
257 0.89
258 0.89
259 0.89
260 0.88
261 0.82
262 0.72
263 0.63
264 0.56
265 0.45
266 0.35
267 0.29
268 0.19
269 0.15
270 0.15
271 0.14
272 0.12
273 0.12
274 0.13
275 0.11
276 0.11
277 0.13
278 0.13