Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6Q1J4

Protein Details
Accession B6Q1J4    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
71-93FESVQPKKTSRNKKASKLFQPLKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 6.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016939  Mt__Rbsml_prot_S25  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG tmf:PMAA_027020  -  
Pfam View protein in Pfam  
PF13741  MRP-S25  
Amino Acid Sequences MGKYNLTALRVRQTALRQKASAKINKLPEWVDIVGDIPPAQVVVRHQPIQHEYLRQRVRTVPGTAESEVFFESVQPKKTSRNKKASKLFQPLKIKYEEDQLRREFFRDHPWELARPRIVLEKSGKDFENYDWSRLQQPGKRLDGESVVQRQLWLLNNVPDMTKTAAYDIARREFYRLRLRQEIEQRVAAEEAEATGAVFGPRMLDVSMALEGKVFEDWKMWAKTQSQLLDQKTAAFVGAPEVAIPADDSKVSAMEAEMEAEAEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.52
3 0.55
4 0.49
5 0.51
6 0.58
7 0.62
8 0.61
9 0.57
10 0.56
11 0.58
12 0.59
13 0.59
14 0.53
15 0.46
16 0.44
17 0.37
18 0.3
19 0.22
20 0.19
21 0.16
22 0.15
23 0.13
24 0.07
25 0.06
26 0.06
27 0.06
28 0.07
29 0.09
30 0.17
31 0.23
32 0.26
33 0.27
34 0.31
35 0.35
36 0.38
37 0.38
38 0.39
39 0.36
40 0.43
41 0.48
42 0.44
43 0.44
44 0.43
45 0.46
46 0.42
47 0.42
48 0.35
49 0.33
50 0.36
51 0.34
52 0.3
53 0.25
54 0.2
55 0.18
56 0.15
57 0.12
58 0.09
59 0.13
60 0.16
61 0.19
62 0.2
63 0.22
64 0.31
65 0.41
66 0.51
67 0.56
68 0.64
69 0.68
70 0.76
71 0.85
72 0.85
73 0.84
74 0.84
75 0.8
76 0.77
77 0.78
78 0.71
79 0.65
80 0.58
81 0.51
82 0.41
83 0.45
84 0.43
85 0.37
86 0.4
87 0.39
88 0.39
89 0.38
90 0.38
91 0.31
92 0.26
93 0.32
94 0.31
95 0.31
96 0.32
97 0.33
98 0.36
99 0.35
100 0.38
101 0.29
102 0.24
103 0.23
104 0.25
105 0.23
106 0.23
107 0.26
108 0.26
109 0.27
110 0.29
111 0.28
112 0.23
113 0.24
114 0.21
115 0.27
116 0.23
117 0.23
118 0.21
119 0.22
120 0.23
121 0.25
122 0.28
123 0.21
124 0.26
125 0.3
126 0.32
127 0.33
128 0.31
129 0.29
130 0.27
131 0.25
132 0.23
133 0.2
134 0.18
135 0.16
136 0.16
137 0.15
138 0.15
139 0.16
140 0.14
141 0.13
142 0.14
143 0.15
144 0.15
145 0.15
146 0.13
147 0.13
148 0.12
149 0.12
150 0.1
151 0.09
152 0.13
153 0.13
154 0.17
155 0.18
156 0.21
157 0.22
158 0.22
159 0.26
160 0.25
161 0.31
162 0.38
163 0.4
164 0.42
165 0.47
166 0.5
167 0.53
168 0.59
169 0.59
170 0.52
171 0.5
172 0.44
173 0.38
174 0.35
175 0.28
176 0.19
177 0.12
178 0.09
179 0.06
180 0.05
181 0.04
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.05
190 0.05
191 0.05
192 0.06
193 0.07
194 0.09
195 0.09
196 0.09
197 0.08
198 0.08
199 0.09
200 0.1
201 0.09
202 0.07
203 0.08
204 0.11
205 0.17
206 0.21
207 0.21
208 0.24
209 0.26
210 0.31
211 0.37
212 0.38
213 0.38
214 0.42
215 0.43
216 0.44
217 0.42
218 0.38
219 0.32
220 0.29
221 0.22
222 0.15
223 0.12
224 0.1
225 0.11
226 0.09
227 0.08
228 0.09
229 0.09
230 0.08
231 0.09
232 0.08
233 0.08
234 0.08
235 0.09
236 0.09
237 0.1
238 0.09
239 0.09
240 0.08
241 0.09
242 0.09
243 0.1
244 0.09