Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A066XEN6

Protein Details
Accession A0A066XEN6    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPSHKSFRTKQKLAKAQKQNRPIPQWHydrophilic
71-92MTDVKHSYNAKRRHWRKSKLGIHydrophilic
NLS Segment(s)
PositionSequence
81-89KRRHWRKSK
Subcellular Location(s) mito 13.5, mito_nucl 12.666, nucl 10.5, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYDNTLGSAPPVSFGTMCRKDGRAGRCRPRSLMEHMTDVKHSYNAKRRHWRKSKLGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.85
4 0.86
5 0.87
6 0.85
7 0.83
8 0.79
9 0.77
10 0.72
11 0.71
12 0.71
13 0.65
14 0.62
15 0.57
16 0.53
17 0.51
18 0.52
19 0.49
20 0.43
21 0.41
22 0.37
23 0.36
24 0.34
25 0.28
26 0.22
27 0.17
28 0.14
29 0.12
30 0.12
31 0.09
32 0.08
33 0.08
34 0.07
35 0.07
36 0.09
37 0.16
38 0.18
39 0.2
40 0.21
41 0.22
42 0.25
43 0.31
44 0.38
45 0.39
46 0.45
47 0.54
48 0.6
49 0.62
50 0.61
51 0.6
52 0.56
53 0.55
54 0.54
55 0.46
56 0.44
57 0.44
58 0.42
59 0.39
60 0.36
61 0.3
62 0.26
63 0.27
64 0.3
65 0.37
66 0.44
67 0.54
68 0.63
69 0.7
70 0.77
71 0.84
72 0.85