Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A066X959

Protein Details
Accession A0A066X959   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
76-95TPGHLPSKSQDRRRKPSELSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 3, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011043  Gal_Oxase/kelch_b-propeller  
IPR015915  Kelch-typ_b-propeller  
IPR006652  Kelch_1  
Pfam View protein in Pfam  
PF13415  Kelch_3  
PF13854  Kelch_5  
PF13964  Kelch_6  
Amino Acid Sequences MADSARSSDKNPRSPLKSKAVRSNKISGPSPGDPPRPSPPPPIAGLPDDLEDLSDRDLDHRRVPSAPGGTLPRSHTPGHLPSKSQDRRRKPSELSIRQRSQSASQTQAAQVQPPPRGTLTTSNASKPPPPSFRPNNTASDATTLNSNDGSESTGGPGSDRDGRRPVAMRSTSAIAGKHSLPLSSSSIRQPSITNSTSRSGPKGQYTPFPPLQDPKTAPDVPPAPSSGMYWSRAPVSGAPHTSLRAHTTTLVGSNIFVFGGCDSRACFNELYVFDADAFYWSVPHVTGEIPVPLRAMTCTAVGKKLVIFGGGDGPAYYNDIYVLDTTNFRWHRPKITSERVPSKRRAHTACLYKNGIYIFGGGDGVRALNDVWRLDVSDMNKMSWKLVSGPERIPPPGVRETRPKPRGYHTANMVGSKLIIFGGSDGGECFNDVWVYDVDAHIWKAVSIPQTFRRLSHTATLVGSYLFVIGGHDGNEYSNDVLLLNLVTMTWDRRRVYGLPPSGRGYHGTVLYDSRLFVIGGFDGSEVFSDVWMLELAVHAYYSQISHFTIEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.75
3 0.75
4 0.76
5 0.75
6 0.77
7 0.79
8 0.79
9 0.78
10 0.78
11 0.73
12 0.71
13 0.66
14 0.6
15 0.57
16 0.52
17 0.54
18 0.53
19 0.55
20 0.5
21 0.52
22 0.55
23 0.54
24 0.55
25 0.54
26 0.52
27 0.5
28 0.5
29 0.49
30 0.45
31 0.42
32 0.4
33 0.33
34 0.29
35 0.25
36 0.21
37 0.17
38 0.15
39 0.13
40 0.12
41 0.11
42 0.1
43 0.14
44 0.21
45 0.24
46 0.29
47 0.31
48 0.32
49 0.33
50 0.36
51 0.38
52 0.35
53 0.33
54 0.31
55 0.33
56 0.33
57 0.35
58 0.37
59 0.35
60 0.35
61 0.35
62 0.34
63 0.35
64 0.42
65 0.47
66 0.46
67 0.44
68 0.44
69 0.55
70 0.6
71 0.64
72 0.66
73 0.67
74 0.74
75 0.78
76 0.82
77 0.76
78 0.78
79 0.79
80 0.8
81 0.79
82 0.8
83 0.78
84 0.72
85 0.69
86 0.61
87 0.55
88 0.52
89 0.47
90 0.42
91 0.39
92 0.4
93 0.38
94 0.41
95 0.36
96 0.31
97 0.3
98 0.3
99 0.32
100 0.3
101 0.32
102 0.26
103 0.28
104 0.28
105 0.31
106 0.31
107 0.35
108 0.36
109 0.37
110 0.39
111 0.39
112 0.4
113 0.37
114 0.4
115 0.4
116 0.42
117 0.49
118 0.56
119 0.62
120 0.63
121 0.63
122 0.6
123 0.56
124 0.53
125 0.44
126 0.38
127 0.3
128 0.24
129 0.23
130 0.18
131 0.15
132 0.13
133 0.13
134 0.1
135 0.09
136 0.11
137 0.09
138 0.09
139 0.09
140 0.1
141 0.1
142 0.09
143 0.09
144 0.11
145 0.18
146 0.18
147 0.21
148 0.24
149 0.26
150 0.29
151 0.32
152 0.32
153 0.33
154 0.33
155 0.31
156 0.29
157 0.3
158 0.28
159 0.27
160 0.25
161 0.17
162 0.18
163 0.17
164 0.18
165 0.16
166 0.14
167 0.13
168 0.16
169 0.19
170 0.18
171 0.2
172 0.2
173 0.23
174 0.24
175 0.24
176 0.22
177 0.22
178 0.27
179 0.27
180 0.25
181 0.25
182 0.26
183 0.29
184 0.3
185 0.29
186 0.26
187 0.27
188 0.31
189 0.33
190 0.33
191 0.35
192 0.36
193 0.4
194 0.39
195 0.38
196 0.35
197 0.35
198 0.36
199 0.36
200 0.34
201 0.3
202 0.33
203 0.32
204 0.31
205 0.31
206 0.31
207 0.27
208 0.27
209 0.25
210 0.19
211 0.18
212 0.19
213 0.17
214 0.18
215 0.17
216 0.17
217 0.16
218 0.16
219 0.16
220 0.16
221 0.14
222 0.16
223 0.17
224 0.17
225 0.18
226 0.18
227 0.19
228 0.19
229 0.18
230 0.17
231 0.14
232 0.14
233 0.13
234 0.13
235 0.13
236 0.12
237 0.12
238 0.09
239 0.08
240 0.07
241 0.07
242 0.06
243 0.05
244 0.04
245 0.04
246 0.05
247 0.05
248 0.05
249 0.06
250 0.08
251 0.08
252 0.1
253 0.1
254 0.09
255 0.13
256 0.13
257 0.15
258 0.14
259 0.14
260 0.12
261 0.12
262 0.12
263 0.08
264 0.08
265 0.05
266 0.05
267 0.05
268 0.05
269 0.05
270 0.05
271 0.05
272 0.05
273 0.06
274 0.06
275 0.08
276 0.08
277 0.08
278 0.08
279 0.08
280 0.08
281 0.07
282 0.08
283 0.07
284 0.08
285 0.1
286 0.1
287 0.11
288 0.11
289 0.12
290 0.1
291 0.11
292 0.1
293 0.08
294 0.08
295 0.07
296 0.09
297 0.08
298 0.08
299 0.06
300 0.07
301 0.06
302 0.08
303 0.07
304 0.05
305 0.05
306 0.06
307 0.06
308 0.06
309 0.07
310 0.06
311 0.07
312 0.08
313 0.16
314 0.17
315 0.18
316 0.24
317 0.26
318 0.32
319 0.35
320 0.43
321 0.44
322 0.53
323 0.58
324 0.59
325 0.67
326 0.68
327 0.7
328 0.7
329 0.7
330 0.67
331 0.67
332 0.64
333 0.61
334 0.6
335 0.65
336 0.61
337 0.59
338 0.55
339 0.47
340 0.45
341 0.39
342 0.31
343 0.22
344 0.17
345 0.11
346 0.08
347 0.09
348 0.06
349 0.06
350 0.05
351 0.05
352 0.04
353 0.05
354 0.04
355 0.06
356 0.08
357 0.08
358 0.08
359 0.09
360 0.1
361 0.1
362 0.13
363 0.13
364 0.18
365 0.18
366 0.18
367 0.21
368 0.2
369 0.21
370 0.18
371 0.18
372 0.14
373 0.2
374 0.24
375 0.25
376 0.26
377 0.3
378 0.32
379 0.31
380 0.31
381 0.26
382 0.27
383 0.32
384 0.34
385 0.33
386 0.41
387 0.48
388 0.56
389 0.61
390 0.6
391 0.55
392 0.59
393 0.65
394 0.62
395 0.62
396 0.56
397 0.58
398 0.55
399 0.52
400 0.45
401 0.35
402 0.29
403 0.21
404 0.17
405 0.08
406 0.06
407 0.05
408 0.05
409 0.06
410 0.06
411 0.06
412 0.06
413 0.07
414 0.07
415 0.08
416 0.07
417 0.07
418 0.07
419 0.06
420 0.09
421 0.08
422 0.09
423 0.1
424 0.09
425 0.1
426 0.12
427 0.12
428 0.11
429 0.1
430 0.09
431 0.09
432 0.13
433 0.17
434 0.17
435 0.22
436 0.28
437 0.36
438 0.36
439 0.37
440 0.4
441 0.38
442 0.38
443 0.4
444 0.36
445 0.31
446 0.31
447 0.3
448 0.24
449 0.21
450 0.18
451 0.12
452 0.09
453 0.06
454 0.06
455 0.05
456 0.06
457 0.07
458 0.07
459 0.07
460 0.07
461 0.08
462 0.09
463 0.1
464 0.09
465 0.09
466 0.09
467 0.08
468 0.08
469 0.08
470 0.07
471 0.05
472 0.05
473 0.04
474 0.05
475 0.07
476 0.11
477 0.16
478 0.22
479 0.24
480 0.25
481 0.3
482 0.32
483 0.38
484 0.43
485 0.48
486 0.47
487 0.5
488 0.52
489 0.5
490 0.48
491 0.44
492 0.39
493 0.34
494 0.3
495 0.28
496 0.26
497 0.26
498 0.27
499 0.25
500 0.21
501 0.17
502 0.16
503 0.14
504 0.13
505 0.13
506 0.1
507 0.1
508 0.1
509 0.09
510 0.08
511 0.08
512 0.08
513 0.08
514 0.08
515 0.07
516 0.07
517 0.07
518 0.08
519 0.08
520 0.07
521 0.06
522 0.06
523 0.07
524 0.07
525 0.07
526 0.06
527 0.07
528 0.08
529 0.08
530 0.09
531 0.1
532 0.11