Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A066X1T2

Protein Details
Accession A0A066X1T2   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
131-165TESSRPPAKATKSKKKRKGGKGKPQEPKPDLRKRTBasic
NLS Segment(s)
PositionSequence
135-164RPPAKATKSKKKRKGGKGKPQEPKPDLRKR
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 7.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR024526  DUF3807  
Pfam View protein in Pfam  
PF12720  DUF3807  
Amino Acid Sequences MTAARMSPTRTQFAAPNVSNDELIAFYEIHFSDAALKSFASDFFNPNQQPSAVDASASFEEDGDIIEEDDGLGYYSDGVKRTLTDEQIAMFRHSELEALRREQERAAERRSVVPCPSQAGETGDDGSLKATESSRPPAKATKSKKKRKGGKGKPQEPKPDLRKRTWDVVEAGLDTLDYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.37
3 0.37
4 0.37
5 0.37
6 0.34
7 0.3
8 0.25
9 0.16
10 0.15
11 0.13
12 0.09
13 0.08
14 0.11
15 0.11
16 0.12
17 0.11
18 0.1
19 0.15
20 0.17
21 0.18
22 0.15
23 0.15
24 0.15
25 0.16
26 0.17
27 0.15
28 0.14
29 0.16
30 0.18
31 0.26
32 0.26
33 0.26
34 0.26
35 0.22
36 0.22
37 0.22
38 0.25
39 0.17
40 0.16
41 0.15
42 0.17
43 0.17
44 0.16
45 0.13
46 0.08
47 0.08
48 0.08
49 0.08
50 0.05
51 0.05
52 0.05
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.03
59 0.03
60 0.03
61 0.03
62 0.05
63 0.06
64 0.07
65 0.08
66 0.07
67 0.08
68 0.11
69 0.13
70 0.13
71 0.12
72 0.12
73 0.12
74 0.14
75 0.15
76 0.13
77 0.11
78 0.1
79 0.09
80 0.09
81 0.09
82 0.07
83 0.1
84 0.11
85 0.13
86 0.16
87 0.16
88 0.17
89 0.17
90 0.22
91 0.24
92 0.27
93 0.29
94 0.28
95 0.29
96 0.34
97 0.36
98 0.33
99 0.29
100 0.27
101 0.25
102 0.25
103 0.25
104 0.19
105 0.18
106 0.18
107 0.17
108 0.15
109 0.15
110 0.12
111 0.12
112 0.11
113 0.1
114 0.08
115 0.07
116 0.07
117 0.07
118 0.1
119 0.13
120 0.21
121 0.25
122 0.27
123 0.29
124 0.35
125 0.42
126 0.49
127 0.56
128 0.6
129 0.66
130 0.76
131 0.84
132 0.87
133 0.9
134 0.91
135 0.92
136 0.92
137 0.93
138 0.93
139 0.93
140 0.93
141 0.91
142 0.91
143 0.84
144 0.83
145 0.82
146 0.81
147 0.78
148 0.75
149 0.76
150 0.72
151 0.76
152 0.7
153 0.64
154 0.56
155 0.53
156 0.47
157 0.39
158 0.33
159 0.23