Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A066X6K4

Protein Details
Accession A0A066X6K4    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
435-457VPTTKPAPVKKGKAKTKVAETVYHydrophilic
NLS Segment(s)
PositionSequence
444-449KKGKAK
Subcellular Location(s) nucl 9, mito 7, cyto 4, plas 4, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018108  Mitochondrial_sb/sol_carrier  
IPR023395  Mt_carrier_dom_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF00153  Mito_carr  
Amino Acid Sequences MASHREGVNPLRPYYKPPTIGEPPDPTSASSAPNPFARHAANATSERYASKARDIFSDIDYKDYISEPSPSVVQTVKDLVDELLWKYASVLTAQPFEVAKTILQVRSHDDVTMGAPAASAAATPLATPVSERLQSQYGSAVSDSDSDLDEPAYFTSNAPSTPTPSFPREHRHRQSPSPPHTPAPKQPVPPYHLTIRRSDSLMEVIGQLWQKEGAWGVWKGSNATFLYSVLSSLLENWSRSALSALFNVPDLGVKEDIDRLIDIASPYPWASLCAAAAAAVATGLILAPLDLVRTRLLVTPTSKQPRRTMSTLRALPSYVCPSLLVVPTILHSLIHPILTLSTPLVLRTRFLIDSRVSPTTFSVAKFCASSVALFVKLPLETVLRRGQVAVLSDPSHVRALSGKEQKLETNVPPGPYYGVVGTMFYIMNEEGSRAVPTTKPAPVKKGKAKTKVAETVYRKGQGLEGLWRGWKVSWWGLVGLWTAGVIGNSAEGEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.5
4 0.49
5 0.55
6 0.57
7 0.62
8 0.62
9 0.59
10 0.55
11 0.53
12 0.51
13 0.43
14 0.39
15 0.35
16 0.32
17 0.31
18 0.3
19 0.29
20 0.33
21 0.34
22 0.31
23 0.34
24 0.32
25 0.3
26 0.29
27 0.29
28 0.31
29 0.31
30 0.33
31 0.31
32 0.3
33 0.27
34 0.27
35 0.29
36 0.25
37 0.3
38 0.31
39 0.3
40 0.33
41 0.36
42 0.35
43 0.33
44 0.39
45 0.31
46 0.3
47 0.29
48 0.26
49 0.23
50 0.22
51 0.21
52 0.14
53 0.17
54 0.15
55 0.17
56 0.17
57 0.16
58 0.17
59 0.17
60 0.17
61 0.16
62 0.18
63 0.16
64 0.16
65 0.16
66 0.14
67 0.14
68 0.15
69 0.13
70 0.14
71 0.14
72 0.13
73 0.13
74 0.15
75 0.13
76 0.13
77 0.15
78 0.14
79 0.16
80 0.16
81 0.17
82 0.16
83 0.16
84 0.16
85 0.13
86 0.11
87 0.13
88 0.17
89 0.18
90 0.2
91 0.21
92 0.25
93 0.28
94 0.29
95 0.25
96 0.21
97 0.19
98 0.18
99 0.18
100 0.13
101 0.08
102 0.08
103 0.07
104 0.07
105 0.06
106 0.05
107 0.04
108 0.04
109 0.04
110 0.04
111 0.05
112 0.05
113 0.05
114 0.06
115 0.08
116 0.11
117 0.13
118 0.13
119 0.16
120 0.18
121 0.19
122 0.19
123 0.19
124 0.16
125 0.15
126 0.15
127 0.13
128 0.1
129 0.11
130 0.11
131 0.08
132 0.08
133 0.08
134 0.08
135 0.08
136 0.07
137 0.07
138 0.07
139 0.09
140 0.09
141 0.08
142 0.11
143 0.11
144 0.11
145 0.14
146 0.14
147 0.16
148 0.17
149 0.21
150 0.23
151 0.25
152 0.28
153 0.29
154 0.39
155 0.44
156 0.53
157 0.56
158 0.62
159 0.64
160 0.7
161 0.76
162 0.76
163 0.75
164 0.72
165 0.67
166 0.61
167 0.63
168 0.59
169 0.56
170 0.55
171 0.53
172 0.49
173 0.52
174 0.54
175 0.52
176 0.51
177 0.47
178 0.46
179 0.47
180 0.45
181 0.43
182 0.42
183 0.38
184 0.35
185 0.32
186 0.25
187 0.2
188 0.19
189 0.15
190 0.11
191 0.09
192 0.11
193 0.11
194 0.09
195 0.08
196 0.08
197 0.07
198 0.07
199 0.08
200 0.06
201 0.09
202 0.09
203 0.1
204 0.12
205 0.12
206 0.13
207 0.13
208 0.16
209 0.13
210 0.14
211 0.13
212 0.11
213 0.12
214 0.1
215 0.1
216 0.07
217 0.07
218 0.05
219 0.06
220 0.08
221 0.08
222 0.08
223 0.09
224 0.09
225 0.09
226 0.09
227 0.09
228 0.08
229 0.07
230 0.08
231 0.08
232 0.08
233 0.08
234 0.08
235 0.07
236 0.07
237 0.06
238 0.07
239 0.07
240 0.07
241 0.07
242 0.08
243 0.08
244 0.08
245 0.07
246 0.06
247 0.06
248 0.06
249 0.06
250 0.06
251 0.06
252 0.06
253 0.06
254 0.07
255 0.06
256 0.06
257 0.07
258 0.07
259 0.06
260 0.06
261 0.06
262 0.05
263 0.05
264 0.04
265 0.03
266 0.02
267 0.02
268 0.02
269 0.02
270 0.02
271 0.02
272 0.02
273 0.02
274 0.02
275 0.02
276 0.03
277 0.03
278 0.04
279 0.05
280 0.06
281 0.07
282 0.09
283 0.11
284 0.14
285 0.16
286 0.2
287 0.29
288 0.38
289 0.41
290 0.43
291 0.47
292 0.52
293 0.55
294 0.55
295 0.54
296 0.51
297 0.56
298 0.56
299 0.52
300 0.45
301 0.4
302 0.35
303 0.32
304 0.29
305 0.2
306 0.16
307 0.14
308 0.15
309 0.17
310 0.17
311 0.14
312 0.09
313 0.09
314 0.1
315 0.11
316 0.1
317 0.07
318 0.06
319 0.09
320 0.09
321 0.09
322 0.09
323 0.08
324 0.09
325 0.09
326 0.09
327 0.06
328 0.07
329 0.07
330 0.09
331 0.11
332 0.11
333 0.11
334 0.13
335 0.16
336 0.15
337 0.16
338 0.2
339 0.18
340 0.22
341 0.26
342 0.27
343 0.24
344 0.23
345 0.23
346 0.22
347 0.23
348 0.19
349 0.18
350 0.16
351 0.17
352 0.16
353 0.15
354 0.14
355 0.13
356 0.12
357 0.12
358 0.13
359 0.13
360 0.12
361 0.13
362 0.12
363 0.11
364 0.11
365 0.1
366 0.11
367 0.11
368 0.15
369 0.2
370 0.2
371 0.2
372 0.2
373 0.2
374 0.19
375 0.21
376 0.19
377 0.17
378 0.17
379 0.18
380 0.18
381 0.19
382 0.18
383 0.15
384 0.14
385 0.15
386 0.19
387 0.28
388 0.36
389 0.36
390 0.37
391 0.39
392 0.4
393 0.41
394 0.41
395 0.34
396 0.34
397 0.34
398 0.33
399 0.32
400 0.31
401 0.28
402 0.23
403 0.23
404 0.14
405 0.14
406 0.12
407 0.12
408 0.12
409 0.11
410 0.11
411 0.09
412 0.1
413 0.08
414 0.09
415 0.09
416 0.09
417 0.09
418 0.1
419 0.11
420 0.1
421 0.12
422 0.12
423 0.16
424 0.2
425 0.26
426 0.34
427 0.37
428 0.46
429 0.53
430 0.62
431 0.68
432 0.74
433 0.77
434 0.79
435 0.84
436 0.82
437 0.82
438 0.8
439 0.75
440 0.75
441 0.71
442 0.69
443 0.67
444 0.63
445 0.54
446 0.47
447 0.43
448 0.38
449 0.35
450 0.34
451 0.3
452 0.28
453 0.3
454 0.29
455 0.29
456 0.25
457 0.25
458 0.24
459 0.25
460 0.27
461 0.26
462 0.27
463 0.26
464 0.27
465 0.25
466 0.19
467 0.14
468 0.1
469 0.09
470 0.08
471 0.08
472 0.06
473 0.05
474 0.06