Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6QTC2

Protein Details
Accession B6QTC2    Localization Confidence High Confidence Score 21.2
NoLS Segment(s)
PositionSequenceProtein Nature
169-196ESGSAEKERRHHRHRHRHRDDEDRRSRHBasic
235-291RRSPSPSRHTSRRSRSPRREHREHRERSYSPQPRRRDRSPRRDRDRDHERNDRRQTWBasic
NLS Segment(s)
PositionSequence
172-200SAEKERRHHRHRHRHRDDEDRRSRHRSRR
210-287RKHRRRRDDSVSGSRSRSPVRQSRSRRSPSPSRHTSRRSRSPRREHREHRERSYSPQPRRRDRSPRRDRDRDHERNDR
Subcellular Location(s) nucl 23, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019339  CIR_N_dom  
IPR022209  CWC25  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
KEGG tmf:PMAA_003270  -  
Pfam View protein in Pfam  
PF10197  Cir_N  
PF12542  CWC25  
Amino Acid Sequences MGGDLNLKKSWNPVLQKNQEKTWLAEKKALEERKRIDQMMRERQEERQMLEIQQLQEAAGGKKRLNRVDWMYSGPSSGQLGTTEEMEGYLLGKRRIDGLIKGSENQKLEKSAAQDSFMALQNANTARDTAAKIREDPMLAIKKQEQAAYEAMMNDPVRRRQLMQAAGKESGSAEKERRHHRHRHRHRDDEDRRSRHRSRRHDYDDDDDDRKHRRRRDDSVSGSRSRSPVRQSRSRRSPSPSRHTSRRSRSPRREHREHRERSYSPQPRRRDRSPRRDRDRDHERNDRRQTWHHNPRPAPPQRESQASSKSIEEERAAKLAAMQQNANDLDKVRGERLAAADAREKAEREADEAARARTSKDGGKGAFLSNINKRAGELDLSERLQRGRRNVEKEQEAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.66
3 0.75
4 0.75
5 0.72
6 0.72
7 0.67
8 0.61
9 0.61
10 0.59
11 0.52
12 0.53
13 0.49
14 0.48
15 0.55
16 0.6
17 0.56
18 0.56
19 0.58
20 0.62
21 0.67
22 0.62
23 0.58
24 0.58
25 0.62
26 0.65
27 0.65
28 0.59
29 0.56
30 0.58
31 0.62
32 0.57
33 0.49
34 0.44
35 0.41
36 0.38
37 0.41
38 0.41
39 0.32
40 0.3
41 0.27
42 0.21
43 0.2
44 0.22
45 0.19
46 0.19
47 0.21
48 0.22
49 0.28
50 0.35
51 0.38
52 0.38
53 0.44
54 0.45
55 0.49
56 0.5
57 0.48
58 0.45
59 0.39
60 0.37
61 0.3
62 0.24
63 0.19
64 0.16
65 0.13
66 0.1
67 0.12
68 0.12
69 0.12
70 0.11
71 0.1
72 0.1
73 0.09
74 0.08
75 0.07
76 0.09
77 0.11
78 0.13
79 0.13
80 0.13
81 0.16
82 0.18
83 0.2
84 0.2
85 0.22
86 0.28
87 0.29
88 0.31
89 0.31
90 0.33
91 0.32
92 0.31
93 0.28
94 0.23
95 0.24
96 0.24
97 0.25
98 0.27
99 0.26
100 0.25
101 0.24
102 0.22
103 0.23
104 0.22
105 0.2
106 0.14
107 0.12
108 0.15
109 0.16
110 0.16
111 0.13
112 0.12
113 0.12
114 0.15
115 0.16
116 0.17
117 0.21
118 0.21
119 0.22
120 0.24
121 0.25
122 0.23
123 0.22
124 0.25
125 0.25
126 0.24
127 0.25
128 0.26
129 0.28
130 0.29
131 0.3
132 0.23
133 0.21
134 0.21
135 0.2
136 0.18
137 0.15
138 0.13
139 0.14
140 0.14
141 0.13
142 0.15
143 0.17
144 0.18
145 0.19
146 0.21
147 0.23
148 0.29
149 0.35
150 0.38
151 0.39
152 0.39
153 0.39
154 0.36
155 0.32
156 0.25
157 0.2
158 0.16
159 0.14
160 0.14
161 0.19
162 0.26
163 0.36
164 0.44
165 0.49
166 0.58
167 0.67
168 0.76
169 0.82
170 0.87
171 0.86
172 0.87
173 0.85
174 0.86
175 0.83
176 0.83
177 0.82
178 0.77
179 0.72
180 0.71
181 0.73
182 0.7
183 0.71
184 0.71
185 0.69
186 0.73
187 0.76
188 0.73
189 0.69
190 0.66
191 0.62
192 0.55
193 0.49
194 0.39
195 0.34
196 0.35
197 0.4
198 0.4
199 0.4
200 0.46
201 0.52
202 0.6
203 0.66
204 0.68
205 0.69
206 0.73
207 0.72
208 0.64
209 0.59
210 0.52
211 0.46
212 0.39
213 0.35
214 0.32
215 0.34
216 0.39
217 0.47
218 0.54
219 0.62
220 0.69
221 0.72
222 0.7
223 0.7
224 0.73
225 0.73
226 0.74
227 0.74
228 0.7
229 0.73
230 0.75
231 0.78
232 0.77
233 0.78
234 0.8
235 0.81
236 0.85
237 0.87
238 0.9
239 0.9
240 0.91
241 0.9
242 0.9
243 0.9
244 0.87
245 0.83
246 0.81
247 0.73
248 0.69
249 0.71
250 0.69
251 0.68
252 0.69
253 0.71
254 0.72
255 0.78
256 0.81
257 0.82
258 0.83
259 0.84
260 0.87
261 0.89
262 0.89
263 0.91
264 0.87
265 0.85
266 0.85
267 0.84
268 0.81
269 0.8
270 0.79
271 0.79
272 0.83
273 0.79
274 0.74
275 0.72
276 0.73
277 0.74
278 0.77
279 0.74
280 0.75
281 0.71
282 0.73
283 0.76
284 0.75
285 0.71
286 0.63
287 0.63
288 0.58
289 0.61
290 0.57
291 0.53
292 0.51
293 0.47
294 0.45
295 0.37
296 0.37
297 0.32
298 0.31
299 0.27
300 0.23
301 0.22
302 0.22
303 0.21
304 0.18
305 0.18
306 0.22
307 0.24
308 0.23
309 0.22
310 0.2
311 0.26
312 0.27
313 0.26
314 0.2
315 0.18
316 0.18
317 0.21
318 0.23
319 0.19
320 0.19
321 0.19
322 0.21
323 0.21
324 0.25
325 0.22
326 0.22
327 0.26
328 0.27
329 0.29
330 0.28
331 0.27
332 0.23
333 0.27
334 0.25
335 0.23
336 0.27
337 0.25
338 0.3
339 0.32
340 0.32
341 0.3
342 0.3
343 0.28
344 0.26
345 0.28
346 0.27
347 0.3
348 0.35
349 0.33
350 0.37
351 0.38
352 0.36
353 0.38
354 0.35
355 0.35
356 0.36
357 0.41
358 0.38
359 0.36
360 0.35
361 0.31
362 0.31
363 0.27
364 0.23
365 0.23
366 0.28
367 0.29
368 0.31
369 0.31
370 0.33
371 0.37
372 0.39
373 0.42
374 0.47
375 0.54
376 0.6
377 0.67
378 0.73