Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6QS60

Protein Details
Accession B6QS60    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
105-125ITEKQRKKSIHFPQRKFAVKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG tmf:PMAA_043860  -  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSAKVKTAQLWGKSKDDLTKQLDELKTELGQLRVQKISQGASSKLNRIHDLRKSIARILTVIKANQRAQLRLFYKGKKYLPLDLRSKQTRAIRRRLTKNEASLITEKQRKKSIHFPQRKFAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.5
3 0.48
4 0.46
5 0.46
6 0.44
7 0.43
8 0.41
9 0.46
10 0.44
11 0.39
12 0.35
13 0.3
14 0.25
15 0.23
16 0.23
17 0.17
18 0.19
19 0.2
20 0.23
21 0.22
22 0.21
23 0.21
24 0.21
25 0.2
26 0.21
27 0.21
28 0.19
29 0.24
30 0.26
31 0.28
32 0.3
33 0.31
34 0.3
35 0.31
36 0.35
37 0.33
38 0.36
39 0.35
40 0.35
41 0.35
42 0.34
43 0.32
44 0.27
45 0.23
46 0.2
47 0.2
48 0.18
49 0.17
50 0.17
51 0.2
52 0.21
53 0.24
54 0.24
55 0.22
56 0.22
57 0.29
58 0.28
59 0.31
60 0.35
61 0.34
62 0.37
63 0.43
64 0.43
65 0.42
66 0.43
67 0.44
68 0.47
69 0.5
70 0.52
71 0.49
72 0.56
73 0.53
74 0.51
75 0.5
76 0.5
77 0.53
78 0.54
79 0.6
80 0.62
81 0.68
82 0.77
83 0.79
84 0.8
85 0.77
86 0.75
87 0.71
88 0.62
89 0.58
90 0.5
91 0.46
92 0.47
93 0.48
94 0.46
95 0.46
96 0.53
97 0.51
98 0.55
99 0.61
100 0.64
101 0.67
102 0.74
103 0.73
104 0.75
105 0.81