Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6Q700

Protein Details
Accession B6Q700   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
142-161GKGKGSTKGKGKRNAGRRGSBasic
NLS Segment(s)
PositionSequence
143-161KGKGSTKGKGKRNAGRRGS
Subcellular Location(s) mito 13, cyto 8, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR003195  TFIID_TAF13  
Gene Ontology GO:0005634  C:nucleus  
GO:0046982  F:protein heterodimerization activity  
GO:0003743  F:translation initiation factor activity  
GO:0006366  P:transcription by RNA polymerase II  
KEGG tmf:PMAA_025440  -  
Pfam View protein in Pfam  
PF02269  TFIID-18kDa  
CDD cd07978  TAF13  
Amino Acid Sequences MAEPRARAARHKGQMNFASDLRTLLSGYGDRDAHPYCAPGPLPETVRVLDEVVTDFILEMCHEAASYASYARRQKIKVDDFRFALRRDPHKLGRVQQLLQMDRELKDARKIFDHDDDQVGTGRKVVEELDGSVDGTVATGTGKGKGSTKGKGKRNAGRRGSDATEETATKKRKVEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.63
3 0.58
4 0.48
5 0.44
6 0.35
7 0.33
8 0.25
9 0.2
10 0.15
11 0.12
12 0.13
13 0.11
14 0.12
15 0.16
16 0.15
17 0.15
18 0.19
19 0.2
20 0.21
21 0.2
22 0.2
23 0.16
24 0.2
25 0.19
26 0.16
27 0.17
28 0.18
29 0.2
30 0.21
31 0.22
32 0.19
33 0.19
34 0.19
35 0.17
36 0.14
37 0.12
38 0.11
39 0.1
40 0.09
41 0.08
42 0.07
43 0.06
44 0.06
45 0.05
46 0.05
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.05
53 0.05
54 0.06
55 0.07
56 0.12
57 0.15
58 0.19
59 0.24
60 0.24
61 0.29
62 0.37
63 0.45
64 0.5
65 0.51
66 0.51
67 0.48
68 0.51
69 0.49
70 0.4
71 0.37
72 0.33
73 0.34
74 0.36
75 0.39
76 0.39
77 0.41
78 0.44
79 0.43
80 0.47
81 0.45
82 0.4
83 0.38
84 0.38
85 0.34
86 0.31
87 0.28
88 0.2
89 0.18
90 0.2
91 0.19
92 0.15
93 0.21
94 0.23
95 0.22
96 0.24
97 0.26
98 0.26
99 0.31
100 0.32
101 0.26
102 0.26
103 0.25
104 0.22
105 0.23
106 0.21
107 0.15
108 0.14
109 0.12
110 0.1
111 0.11
112 0.1
113 0.09
114 0.09
115 0.1
116 0.11
117 0.11
118 0.11
119 0.1
120 0.1
121 0.08
122 0.07
123 0.06
124 0.03
125 0.03
126 0.05
127 0.05
128 0.08
129 0.1
130 0.11
131 0.14
132 0.21
133 0.26
134 0.32
135 0.42
136 0.48
137 0.56
138 0.64
139 0.71
140 0.73
141 0.78
142 0.81
143 0.79
144 0.76
145 0.72
146 0.68
147 0.63
148 0.58
149 0.5
150 0.43
151 0.39
152 0.34
153 0.33
154 0.35
155 0.37
156 0.37