Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A066XPW1

Protein Details
Accession A0A066XPW1    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
219-240QGRPAKIKPKPDEDKRQRRLEEBasic
NLS Segment(s)
PositionSequence
226-228KPK
Subcellular Location(s) nucl 13.5, cyto_nucl 13.5, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020993  Centromere_CenpK  
IPR013819  LipOase_C  
Gene Ontology GO:0000775  C:chromosome, centromeric region  
GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0016702  F:oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen  
GO:0051382  P:kinetochore assembly  
PROSITE View protein in PROSITE  
PS51393  LIPOXYGENASE_3  
Amino Acid Sequences MDGSPRPVGDRYALSLEQSLQELRQNIQQHKEKLAALQGSDSHRNRNPSGAGREPYEVMKSAFEQVAGTPPFVPFSESVLPALLALRKTHQTITESQAYLTSQGASLDRTKRRLEIEQANLADQKLLQQSLEKRIQSLKDEAESRMGLTPEQAAQERLDELRQKKKRYDRETSGLLKALRKFIDDHLAAQLAAEDLGGPVVGEMMEIDSDQLIAGFNAQGRPAKIKPKPDEDKRQRRLEEVWGLPQEDTGQKRGEADEAAAAGREMRALTEQLLNQLVESGGDSTMAYVKLHKETAAVRFLVRSKVAQFHPRDATKLKLIDFGRELDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.26
4 0.24
5 0.23
6 0.2
7 0.15
8 0.19
9 0.2
10 0.2
11 0.25
12 0.31
13 0.34
14 0.43
15 0.5
16 0.5
17 0.52
18 0.54
19 0.48
20 0.44
21 0.46
22 0.38
23 0.31
24 0.29
25 0.29
26 0.31
27 0.39
28 0.37
29 0.38
30 0.4
31 0.45
32 0.44
33 0.45
34 0.45
35 0.44
36 0.5
37 0.5
38 0.48
39 0.45
40 0.46
41 0.42
42 0.38
43 0.33
44 0.27
45 0.2
46 0.19
47 0.18
48 0.19
49 0.18
50 0.16
51 0.14
52 0.13
53 0.2
54 0.19
55 0.18
56 0.15
57 0.15
58 0.17
59 0.16
60 0.18
61 0.11
62 0.15
63 0.18
64 0.18
65 0.18
66 0.17
67 0.17
68 0.15
69 0.16
70 0.13
71 0.1
72 0.11
73 0.13
74 0.15
75 0.17
76 0.19
77 0.2
78 0.21
79 0.24
80 0.29
81 0.32
82 0.3
83 0.29
84 0.28
85 0.25
86 0.23
87 0.2
88 0.14
89 0.08
90 0.09
91 0.09
92 0.1
93 0.15
94 0.21
95 0.25
96 0.29
97 0.3
98 0.32
99 0.35
100 0.38
101 0.4
102 0.41
103 0.42
104 0.44
105 0.43
106 0.41
107 0.38
108 0.34
109 0.26
110 0.18
111 0.16
112 0.11
113 0.11
114 0.1
115 0.13
116 0.16
117 0.24
118 0.29
119 0.26
120 0.26
121 0.29
122 0.31
123 0.3
124 0.31
125 0.25
126 0.23
127 0.25
128 0.24
129 0.23
130 0.21
131 0.18
132 0.17
133 0.15
134 0.12
135 0.1
136 0.11
137 0.09
138 0.1
139 0.1
140 0.09
141 0.09
142 0.09
143 0.1
144 0.09
145 0.11
146 0.15
147 0.18
148 0.28
149 0.33
150 0.36
151 0.43
152 0.52
153 0.6
154 0.62
155 0.67
156 0.63
157 0.63
158 0.66
159 0.62
160 0.55
161 0.48
162 0.41
163 0.36
164 0.31
165 0.29
166 0.23
167 0.21
168 0.21
169 0.19
170 0.25
171 0.21
172 0.21
173 0.18
174 0.19
175 0.17
176 0.15
177 0.14
178 0.06
179 0.06
180 0.05
181 0.03
182 0.03
183 0.03
184 0.03
185 0.02
186 0.02
187 0.02
188 0.02
189 0.02
190 0.02
191 0.02
192 0.03
193 0.03
194 0.03
195 0.03
196 0.03
197 0.03
198 0.03
199 0.03
200 0.03
201 0.04
202 0.04
203 0.05
204 0.06
205 0.07
206 0.09
207 0.1
208 0.16
209 0.19
210 0.28
211 0.31
212 0.4
213 0.45
214 0.54
215 0.62
216 0.67
217 0.75
218 0.77
219 0.84
220 0.82
221 0.85
222 0.77
223 0.71
224 0.64
225 0.61
226 0.58
227 0.5
228 0.48
229 0.4
230 0.4
231 0.36
232 0.33
233 0.27
234 0.23
235 0.23
236 0.2
237 0.19
238 0.19
239 0.2
240 0.21
241 0.2
242 0.16
243 0.14
244 0.13
245 0.12
246 0.11
247 0.1
248 0.09
249 0.08
250 0.07
251 0.07
252 0.05
253 0.06
254 0.07
255 0.08
256 0.1
257 0.14
258 0.15
259 0.17
260 0.19
261 0.18
262 0.16
263 0.16
264 0.14
265 0.1
266 0.1
267 0.09
268 0.06
269 0.07
270 0.07
271 0.07
272 0.1
273 0.1
274 0.1
275 0.11
276 0.15
277 0.18
278 0.19
279 0.19
280 0.19
281 0.23
282 0.28
283 0.3
284 0.28
285 0.25
286 0.28
287 0.31
288 0.33
289 0.3
290 0.28
291 0.27
292 0.34
293 0.39
294 0.44
295 0.46
296 0.49
297 0.56
298 0.55
299 0.57
300 0.53
301 0.53
302 0.51
303 0.51
304 0.44
305 0.43
306 0.42
307 0.43
308 0.41