Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A066X1P8

Protein Details
Accession A0A066X1P8    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-50MPSSRPTRPTRARRARLSSSRHRTRGRRVKKVKPCRHPRLPKTTLPQEHDBasic
NLS Segment(s)
PositionSequence
7-39TRPTRARRARLSSSRHRTRGRRVKKVKPCRHPR
Subcellular Location(s) mito 17, nucl 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MPSSRPTRPTRARRARLSSSRHRTRGRRVKKVKPCRHPRLPKTTLPQEHDGQDADEPRPLIPLSPFSYGATPLLNMTCGHFLQCELQPHQTAARDSFVKCYLESSPRGAAWGKLPAQRLQDFEQGNGSKQDEAEAAFLEGSLRSMMKCLDEYFFFGTLTRLQEGQQHLFLVLHTGFGRLKADVADCRYGDATTSPGHWNRDHAYSRIRIWSRMAVDNPYSRDSPRETRRLAFTTNVSTLIHEIVHVYLELFVCRGGQCRRNILNTTGVSGHASTFIKLYALVLGEVWKWHPELGTLAKRHCMPGSSVVRFNIYVETMKRLELEAEGRIRGLLPLRADSPRNLVRQTEALIDGMSVMSITYRRPGSRIPGQEEADGNCVMNDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.87
4 0.86
5 0.86
6 0.85
7 0.86
8 0.85
9 0.86
10 0.84
11 0.86
12 0.88
13 0.87
14 0.88
15 0.87
16 0.89
17 0.91
18 0.94
19 0.93
20 0.93
21 0.93
22 0.93
23 0.94
24 0.94
25 0.93
26 0.93
27 0.89
28 0.86
29 0.84
30 0.84
31 0.81
32 0.76
33 0.72
34 0.65
35 0.6
36 0.53
37 0.44
38 0.35
39 0.31
40 0.28
41 0.23
42 0.22
43 0.2
44 0.18
45 0.2
46 0.18
47 0.16
48 0.15
49 0.2
50 0.21
51 0.24
52 0.25
53 0.24
54 0.25
55 0.24
56 0.23
57 0.18
58 0.14
59 0.12
60 0.12
61 0.12
62 0.11
63 0.12
64 0.14
65 0.13
66 0.13
67 0.12
68 0.13
69 0.16
70 0.2
71 0.24
72 0.24
73 0.27
74 0.27
75 0.28
76 0.31
77 0.3
78 0.28
79 0.24
80 0.25
81 0.25
82 0.24
83 0.27
84 0.28
85 0.25
86 0.23
87 0.23
88 0.23
89 0.25
90 0.27
91 0.27
92 0.26
93 0.24
94 0.26
95 0.25
96 0.22
97 0.19
98 0.23
99 0.24
100 0.26
101 0.28
102 0.3
103 0.35
104 0.36
105 0.36
106 0.34
107 0.37
108 0.33
109 0.31
110 0.34
111 0.29
112 0.28
113 0.27
114 0.24
115 0.18
116 0.17
117 0.18
118 0.12
119 0.12
120 0.11
121 0.09
122 0.08
123 0.07
124 0.07
125 0.06
126 0.06
127 0.05
128 0.05
129 0.05
130 0.05
131 0.06
132 0.06
133 0.07
134 0.08
135 0.09
136 0.1
137 0.1
138 0.13
139 0.14
140 0.14
141 0.13
142 0.12
143 0.12
144 0.13
145 0.14
146 0.13
147 0.11
148 0.11
149 0.16
150 0.19
151 0.2
152 0.18
153 0.16
154 0.16
155 0.15
156 0.15
157 0.12
158 0.09
159 0.08
160 0.07
161 0.09
162 0.08
163 0.09
164 0.1
165 0.07
166 0.08
167 0.07
168 0.09
169 0.1
170 0.12
171 0.14
172 0.13
173 0.14
174 0.14
175 0.13
176 0.12
177 0.1
178 0.09
179 0.07
180 0.1
181 0.12
182 0.14
183 0.17
184 0.17
185 0.19
186 0.2
187 0.26
188 0.26
189 0.25
190 0.27
191 0.27
192 0.28
193 0.33
194 0.32
195 0.26
196 0.26
197 0.29
198 0.28
199 0.29
200 0.28
201 0.23
202 0.25
203 0.27
204 0.27
205 0.25
206 0.23
207 0.2
208 0.21
209 0.23
210 0.29
211 0.33
212 0.38
213 0.38
214 0.4
215 0.45
216 0.45
217 0.42
218 0.36
219 0.31
220 0.28
221 0.27
222 0.25
223 0.2
224 0.18
225 0.16
226 0.14
227 0.12
228 0.08
229 0.07
230 0.06
231 0.06
232 0.06
233 0.05
234 0.06
235 0.06
236 0.06
237 0.06
238 0.06
239 0.06
240 0.07
241 0.12
242 0.15
243 0.21
244 0.24
245 0.32
246 0.36
247 0.4
248 0.43
249 0.4
250 0.43
251 0.37
252 0.36
253 0.29
254 0.26
255 0.22
256 0.19
257 0.17
258 0.13
259 0.13
260 0.11
261 0.11
262 0.11
263 0.1
264 0.1
265 0.1
266 0.07
267 0.07
268 0.07
269 0.07
270 0.08
271 0.08
272 0.09
273 0.09
274 0.09
275 0.09
276 0.1
277 0.1
278 0.09
279 0.13
280 0.21
281 0.27
282 0.3
283 0.31
284 0.34
285 0.35
286 0.36
287 0.33
288 0.27
289 0.22
290 0.29
291 0.36
292 0.36
293 0.38
294 0.37
295 0.38
296 0.36
297 0.34
298 0.27
299 0.2
300 0.19
301 0.18
302 0.22
303 0.21
304 0.21
305 0.21
306 0.19
307 0.18
308 0.17
309 0.18
310 0.18
311 0.2
312 0.2
313 0.2
314 0.19
315 0.18
316 0.18
317 0.18
318 0.17
319 0.16
320 0.19
321 0.22
322 0.26
323 0.28
324 0.28
325 0.33
326 0.36
327 0.38
328 0.38
329 0.36
330 0.35
331 0.36
332 0.36
333 0.32
334 0.26
335 0.22
336 0.2
337 0.18
338 0.15
339 0.12
340 0.09
341 0.06
342 0.04
343 0.05
344 0.06
345 0.07
346 0.13
347 0.18
348 0.19
349 0.22
350 0.27
351 0.34
352 0.43
353 0.5
354 0.51
355 0.55
356 0.56
357 0.57
358 0.55
359 0.49
360 0.43
361 0.35
362 0.28