Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A066X1B1

Protein Details
Accession A0A066X1B1   
Localization Confidence Low
Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
49-82TTMMTPKSYRCRPRRQHKQHKQQHHSHHNNISQNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, nucl 3
Family & Domain DBs
Amino Acid Sequences MLTKHWQMLPVKQQGWILIQKTLKTLTIPLMRTRMRLYPAMNQSIYLGTTMMTPKSYRCRPRRQHKQHKQQHHSHHNNISQNITL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.38
4 0.31
5 0.28
6 0.29
7 0.27
8 0.28
9 0.27
10 0.23
11 0.19
12 0.19
13 0.2
14 0.24
15 0.25
16 0.26
17 0.31
18 0.31
19 0.32
20 0.33
21 0.29
22 0.26
23 0.28
24 0.27
25 0.28
26 0.32
27 0.33
28 0.31
29 0.28
30 0.25
31 0.22
32 0.2
33 0.12
34 0.08
35 0.05
36 0.06
37 0.07
38 0.07
39 0.08
40 0.08
41 0.11
42 0.2
43 0.28
44 0.37
45 0.45
46 0.56
47 0.66
48 0.77
49 0.85
50 0.88
51 0.92
52 0.93
53 0.95
54 0.94
55 0.95
56 0.93
57 0.91
58 0.91
59 0.91
60 0.89
61 0.86
62 0.85
63 0.8
64 0.78
65 0.71