Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A066X5K4

Protein Details
Accession A0A066X5K4    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
296-315GGNGRNGKNQQNNNNNNNNNHydrophilic
332-351NNKREFRNTFSSRRARRNVVHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 22, cyto 2, nucl 1, mito 1, plas 1, mito_nucl 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR021476  Egh16-like  
Pfam View protein in Pfam  
PF11327  Egh16-like  
Amino Acid Sequences MSSPMRALVASAMLAMAHAQGVILKAQGPSGPASPGLLVDPTKADANIINQQEIVQNVVNECGRTILAGNIDIGETTEAQLGNKTVTHVTKGSNVDITIAQVSQDGAGPYTCDLDPTSNANGATGQTNLTVKESKAQNGNIKLTVTMPKDLACVGASTGNVCTVRCFNSNAKGPFGGCVAVQQTDTKPKKNTPGNIPTAQTLDGVLSQIQQNIVDLPAAVKSNQDAATQDEQGVTAVKEILGNDATLKAAGPAEKGNANNGNANAGKGGNRGNGAGKNNGAGKNNGNGNGANAQAGGNGRNGKNQQNNNNNNNNNDNNNNNDNNNNNDNNNNNKREFRNTFSSRRARRNVVPAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.04
5 0.04
6 0.04
7 0.05
8 0.06
9 0.07
10 0.07
11 0.09
12 0.09
13 0.1
14 0.11
15 0.12
16 0.14
17 0.14
18 0.15
19 0.14
20 0.14
21 0.14
22 0.13
23 0.13
24 0.13
25 0.12
26 0.12
27 0.13
28 0.14
29 0.14
30 0.14
31 0.14
32 0.13
33 0.18
34 0.24
35 0.24
36 0.23
37 0.22
38 0.23
39 0.24
40 0.22
41 0.2
42 0.14
43 0.13
44 0.13
45 0.16
46 0.16
47 0.14
48 0.14
49 0.12
50 0.11
51 0.1
52 0.11
53 0.1
54 0.1
55 0.11
56 0.11
57 0.1
58 0.1
59 0.09
60 0.09
61 0.08
62 0.07
63 0.07
64 0.09
65 0.09
66 0.09
67 0.1
68 0.1
69 0.1
70 0.11
71 0.12
72 0.13
73 0.14
74 0.17
75 0.17
76 0.18
77 0.24
78 0.26
79 0.25
80 0.24
81 0.22
82 0.21
83 0.2
84 0.19
85 0.13
86 0.11
87 0.09
88 0.08
89 0.08
90 0.07
91 0.08
92 0.07
93 0.07
94 0.07
95 0.07
96 0.07
97 0.09
98 0.09
99 0.08
100 0.09
101 0.1
102 0.12
103 0.15
104 0.16
105 0.15
106 0.16
107 0.15
108 0.15
109 0.14
110 0.13
111 0.1
112 0.09
113 0.08
114 0.09
115 0.09
116 0.11
117 0.12
118 0.11
119 0.17
120 0.18
121 0.2
122 0.24
123 0.28
124 0.32
125 0.35
126 0.37
127 0.31
128 0.3
129 0.27
130 0.24
131 0.26
132 0.22
133 0.18
134 0.17
135 0.16
136 0.16
137 0.16
138 0.14
139 0.09
140 0.07
141 0.06
142 0.07
143 0.07
144 0.07
145 0.07
146 0.09
147 0.09
148 0.08
149 0.09
150 0.09
151 0.12
152 0.13
153 0.16
154 0.16
155 0.22
156 0.29
157 0.29
158 0.29
159 0.27
160 0.26
161 0.23
162 0.22
163 0.15
164 0.08
165 0.08
166 0.08
167 0.08
168 0.08
169 0.08
170 0.09
171 0.19
172 0.21
173 0.25
174 0.27
175 0.29
176 0.38
177 0.43
178 0.48
179 0.47
180 0.53
181 0.55
182 0.54
183 0.52
184 0.44
185 0.39
186 0.34
187 0.25
188 0.16
189 0.11
190 0.08
191 0.07
192 0.07
193 0.06
194 0.06
195 0.07
196 0.07
197 0.07
198 0.07
199 0.07
200 0.07
201 0.06
202 0.05
203 0.05
204 0.06
205 0.07
206 0.07
207 0.06
208 0.07
209 0.11
210 0.12
211 0.12
212 0.12
213 0.16
214 0.19
215 0.19
216 0.19
217 0.15
218 0.14
219 0.14
220 0.14
221 0.09
222 0.06
223 0.06
224 0.06
225 0.07
226 0.07
227 0.09
228 0.08
229 0.08
230 0.08
231 0.08
232 0.08
233 0.07
234 0.07
235 0.06
236 0.07
237 0.07
238 0.08
239 0.08
240 0.1
241 0.13
242 0.14
243 0.18
244 0.21
245 0.22
246 0.23
247 0.22
248 0.25
249 0.22
250 0.22
251 0.18
252 0.15
253 0.14
254 0.13
255 0.16
256 0.14
257 0.14
258 0.15
259 0.18
260 0.23
261 0.24
262 0.25
263 0.23
264 0.24
265 0.28
266 0.31
267 0.29
268 0.27
269 0.26
270 0.29
271 0.32
272 0.31
273 0.28
274 0.24
275 0.25
276 0.24
277 0.22
278 0.17
279 0.14
280 0.11
281 0.12
282 0.13
283 0.11
284 0.13
285 0.18
286 0.19
287 0.25
288 0.29
289 0.36
290 0.44
291 0.51
292 0.57
293 0.63
294 0.72
295 0.74
296 0.8
297 0.76
298 0.71
299 0.7
300 0.64
301 0.58
302 0.54
303 0.48
304 0.45
305 0.48
306 0.46
307 0.42
308 0.42
309 0.41
310 0.42
311 0.45
312 0.42
313 0.38
314 0.39
315 0.43
316 0.49
317 0.54
318 0.54
319 0.52
320 0.56
321 0.59
322 0.64
323 0.64
324 0.61
325 0.62
326 0.63
327 0.67
328 0.7
329 0.76
330 0.75
331 0.79
332 0.8
333 0.77
334 0.78