Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6Q5M1

Protein Details
Accession B6Q5M1    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MNSCLNSPHQRRRMRRQSREVNEILPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 4, cyto 3.5
Family & Domain DBs
KEGG tmf:PMAA_032820  -  
Amino Acid Sequences MNSCLNSPHQRRRMRRQSREVNEILPIETYLYRCDPYRSSTVKHPWSYGVKVLEYPSIRSLILTYKNDIRDTFIKHGFPADGSGVKLNFAVKRVSPRGQPASTVLSIGIENDPVSNRDLSAVRDAIRDLLLSRSLKTVHVDIYDCDRRFFPRRFNIPGDHPAAIRYNELKGDIMRLLRKHIDLPWQSVCLHQVGRSLGQATPCIVLCVAPGAIYNWASLRRQILNMLGFADIEVEFLPEIIKKKQSTESRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.9
3 0.9
4 0.92
5 0.9
6 0.89
7 0.8
8 0.71
9 0.64
10 0.54
11 0.44
12 0.33
13 0.25
14 0.19
15 0.18
16 0.16
17 0.15
18 0.16
19 0.17
20 0.18
21 0.22
22 0.22
23 0.25
24 0.33
25 0.34
26 0.36
27 0.44
28 0.52
29 0.57
30 0.57
31 0.53
32 0.51
33 0.52
34 0.51
35 0.47
36 0.41
37 0.33
38 0.32
39 0.32
40 0.31
41 0.27
42 0.26
43 0.23
44 0.21
45 0.2
46 0.18
47 0.18
48 0.18
49 0.24
50 0.24
51 0.25
52 0.29
53 0.32
54 0.33
55 0.32
56 0.32
57 0.29
58 0.33
59 0.35
60 0.34
61 0.32
62 0.31
63 0.32
64 0.27
65 0.23
66 0.19
67 0.15
68 0.12
69 0.12
70 0.13
71 0.12
72 0.12
73 0.12
74 0.12
75 0.12
76 0.12
77 0.13
78 0.13
79 0.2
80 0.25
81 0.27
82 0.28
83 0.33
84 0.38
85 0.37
86 0.36
87 0.31
88 0.31
89 0.28
90 0.25
91 0.19
92 0.13
93 0.12
94 0.12
95 0.1
96 0.06
97 0.05
98 0.06
99 0.06
100 0.07
101 0.08
102 0.07
103 0.07
104 0.09
105 0.1
106 0.1
107 0.12
108 0.13
109 0.12
110 0.12
111 0.12
112 0.11
113 0.1
114 0.09
115 0.07
116 0.07
117 0.1
118 0.1
119 0.11
120 0.11
121 0.12
122 0.13
123 0.14
124 0.14
125 0.12
126 0.13
127 0.13
128 0.12
129 0.19
130 0.25
131 0.24
132 0.24
133 0.23
134 0.26
135 0.32
136 0.35
137 0.36
138 0.39
139 0.45
140 0.49
141 0.53
142 0.52
143 0.51
144 0.53
145 0.48
146 0.39
147 0.33
148 0.29
149 0.27
150 0.24
151 0.21
152 0.17
153 0.15
154 0.14
155 0.15
156 0.15
157 0.12
158 0.14
159 0.14
160 0.16
161 0.18
162 0.18
163 0.22
164 0.23
165 0.24
166 0.24
167 0.25
168 0.31
169 0.3
170 0.34
171 0.33
172 0.32
173 0.31
174 0.3
175 0.29
176 0.22
177 0.2
178 0.16
179 0.17
180 0.17
181 0.18
182 0.19
183 0.19
184 0.18
185 0.19
186 0.18
187 0.16
188 0.16
189 0.14
190 0.14
191 0.12
192 0.1
193 0.09
194 0.1
195 0.09
196 0.07
197 0.07
198 0.08
199 0.1
200 0.11
201 0.11
202 0.11
203 0.14
204 0.15
205 0.17
206 0.21
207 0.21
208 0.23
209 0.24
210 0.28
211 0.27
212 0.27
213 0.25
214 0.21
215 0.18
216 0.16
217 0.15
218 0.1
219 0.08
220 0.07
221 0.07
222 0.07
223 0.07
224 0.08
225 0.09
226 0.13
227 0.17
228 0.24
229 0.25
230 0.3
231 0.39