Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A066X8S6

Protein Details
Accession A0A066X8S6   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
299-322SIRSHASRERRHSRKEAPPPRGEDBasic
NLS Segment(s)
PositionSequence
306-317RERRHSRKEAPP
Subcellular Location(s) nucl 16, mito 6, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR046497  DUF6590  
Pfam View protein in Pfam  
PF20233  DUF6590  
Amino Acid Sequences MVIGNRDFSTFRSKSTKSTKSDSGNGDDASIGTHDSSYEHPLARKGYDIGPASRCEVGDVFEFLWADSHEFEWEWKCLGYTRFIVLRHSDTFPHHCVCVPISTPTKNDFQKPGIDSSQQGYVFDENDRTPPFDRLPFSPVGMQLRPGKFRVKENSRANYADVLEIDHDAQVMVVGDVTRYFDRVRRNVNKAVMRNVLKKALEQYRQGKLVGAKGAKLEASVVNGGSQDDDEPEGESDPDHPDVFIMPDETASVIEKRQPEPLISAEMPPPPPPAPPLPPMDSPMPIQQQPSPPRDDAASIRSHASRERRHSRKEAPPPRGEDFSRRMSDQHVDGASRPYRQRIELPRSRSHRHSEHETGSMYDVATAKAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.54
3 0.61
4 0.57
5 0.63
6 0.66
7 0.64
8 0.7
9 0.66
10 0.62
11 0.57
12 0.51
13 0.45
14 0.36
15 0.29
16 0.23
17 0.18
18 0.12
19 0.08
20 0.08
21 0.07
22 0.09
23 0.11
24 0.16
25 0.19
26 0.21
27 0.22
28 0.26
29 0.29
30 0.28
31 0.29
32 0.26
33 0.25
34 0.3
35 0.31
36 0.32
37 0.32
38 0.33
39 0.33
40 0.32
41 0.29
42 0.24
43 0.21
44 0.18
45 0.17
46 0.17
47 0.14
48 0.14
49 0.15
50 0.12
51 0.13
52 0.12
53 0.11
54 0.1
55 0.1
56 0.1
57 0.1
58 0.12
59 0.14
60 0.14
61 0.14
62 0.13
63 0.14
64 0.17
65 0.18
66 0.2
67 0.19
68 0.22
69 0.25
70 0.26
71 0.28
72 0.28
73 0.31
74 0.3
75 0.3
76 0.28
77 0.29
78 0.34
79 0.35
80 0.33
81 0.29
82 0.26
83 0.26
84 0.25
85 0.23
86 0.19
87 0.21
88 0.24
89 0.26
90 0.28
91 0.29
92 0.35
93 0.35
94 0.37
95 0.36
96 0.34
97 0.38
98 0.37
99 0.39
100 0.35
101 0.33
102 0.3
103 0.27
104 0.31
105 0.24
106 0.22
107 0.19
108 0.17
109 0.17
110 0.16
111 0.17
112 0.12
113 0.15
114 0.16
115 0.17
116 0.17
117 0.2
118 0.21
119 0.23
120 0.25
121 0.24
122 0.27
123 0.25
124 0.25
125 0.23
126 0.23
127 0.23
128 0.21
129 0.23
130 0.25
131 0.27
132 0.28
133 0.29
134 0.32
135 0.31
136 0.37
137 0.43
138 0.44
139 0.51
140 0.57
141 0.6
142 0.58
143 0.56
144 0.51
145 0.43
146 0.36
147 0.27
148 0.19
149 0.14
150 0.11
151 0.1
152 0.09
153 0.07
154 0.06
155 0.05
156 0.05
157 0.04
158 0.04
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.05
165 0.05
166 0.06
167 0.07
168 0.11
169 0.17
170 0.21
171 0.31
172 0.36
173 0.41
174 0.45
175 0.51
176 0.54
177 0.5
178 0.5
179 0.47
180 0.44
181 0.43
182 0.39
183 0.37
184 0.31
185 0.3
186 0.31
187 0.32
188 0.33
189 0.34
190 0.38
191 0.38
192 0.39
193 0.39
194 0.35
195 0.29
196 0.28
197 0.27
198 0.22
199 0.19
200 0.18
201 0.18
202 0.15
203 0.14
204 0.12
205 0.07
206 0.09
207 0.08
208 0.08
209 0.08
210 0.08
211 0.08
212 0.07
213 0.07
214 0.05
215 0.05
216 0.06
217 0.06
218 0.07
219 0.07
220 0.07
221 0.07
222 0.07
223 0.08
224 0.1
225 0.11
226 0.1
227 0.09
228 0.09
229 0.1
230 0.1
231 0.09
232 0.08
233 0.06
234 0.06
235 0.07
236 0.07
237 0.07
238 0.07
239 0.08
240 0.08
241 0.12
242 0.15
243 0.16
244 0.21
245 0.22
246 0.21
247 0.23
248 0.24
249 0.26
250 0.23
251 0.24
252 0.21
253 0.23
254 0.23
255 0.22
256 0.24
257 0.19
258 0.19
259 0.21
260 0.23
261 0.25
262 0.28
263 0.32
264 0.33
265 0.34
266 0.37
267 0.35
268 0.32
269 0.3
270 0.32
271 0.31
272 0.28
273 0.28
274 0.29
275 0.36
276 0.41
277 0.43
278 0.43
279 0.39
280 0.39
281 0.37
282 0.36
283 0.31
284 0.28
285 0.28
286 0.24
287 0.26
288 0.26
289 0.27
290 0.3
291 0.35
292 0.4
293 0.47
294 0.56
295 0.62
296 0.69
297 0.76
298 0.79
299 0.81
300 0.83
301 0.83
302 0.82
303 0.81
304 0.8
305 0.75
306 0.72
307 0.64
308 0.61
309 0.56
310 0.55
311 0.52
312 0.46
313 0.42
314 0.41
315 0.42
316 0.36
317 0.37
318 0.3
319 0.28
320 0.28
321 0.35
322 0.34
323 0.36
324 0.36
325 0.38
326 0.39
327 0.41
328 0.49
329 0.52
330 0.59
331 0.61
332 0.65
333 0.68
334 0.72
335 0.75
336 0.73
337 0.72
338 0.7
339 0.69
340 0.71
341 0.69
342 0.66
343 0.64
344 0.59
345 0.51
346 0.45
347 0.39
348 0.29
349 0.24
350 0.2