Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6QJZ8

Protein Details
Accession B6QJZ8    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-45IGAHYKDLKAYRKRKREGKDTKTNNKKKRTDEPRRRRCWDWMBasic
NLS Segment(s)
PositionSequence
12-39KAYRKRKREGKDTKTNNKKKRTDEPRRR
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
KEGG tmf:PMAA_101410  -  
Amino Acid Sequences MGEIGAHYKDLKAYRKRKREGKDTKTNNKKKRTDEPRRRRCWDWMITTGNCHYAKNRSSFKEYRRVGKSIPNGVIEGILTFIAGVGSVELRVRTAYEERSSVRTLVLQDVLHIPVELKVQNLHEKNSPIRTLVLKNVLHGLHEPIRRVRWRYETSLVQQMAPRNGSQADPTW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.69
3 0.78
4 0.82
5 0.85
6 0.87
7 0.88
8 0.87
9 0.88
10 0.88
11 0.89
12 0.91
13 0.92
14 0.91
15 0.9
16 0.88
17 0.84
18 0.85
19 0.85
20 0.85
21 0.86
22 0.88
23 0.89
24 0.9
25 0.89
26 0.82
27 0.79
28 0.77
29 0.73
30 0.68
31 0.64
32 0.6
33 0.55
34 0.53
35 0.46
36 0.43
37 0.35
38 0.29
39 0.25
40 0.26
41 0.29
42 0.34
43 0.4
44 0.37
45 0.44
46 0.5
47 0.53
48 0.56
49 0.55
50 0.56
51 0.54
52 0.53
53 0.46
54 0.48
55 0.49
56 0.44
57 0.44
58 0.36
59 0.32
60 0.29
61 0.28
62 0.2
63 0.14
64 0.08
65 0.05
66 0.04
67 0.03
68 0.03
69 0.03
70 0.03
71 0.02
72 0.02
73 0.02
74 0.03
75 0.03
76 0.03
77 0.03
78 0.04
79 0.04
80 0.06
81 0.08
82 0.11
83 0.12
84 0.14
85 0.16
86 0.19
87 0.2
88 0.18
89 0.17
90 0.16
91 0.15
92 0.15
93 0.16
94 0.12
95 0.12
96 0.13
97 0.14
98 0.12
99 0.11
100 0.09
101 0.08
102 0.1
103 0.1
104 0.09
105 0.1
106 0.13
107 0.21
108 0.22
109 0.23
110 0.25
111 0.29
112 0.33
113 0.36
114 0.34
115 0.28
116 0.29
117 0.3
118 0.29
119 0.31
120 0.35
121 0.3
122 0.3
123 0.33
124 0.3
125 0.28
126 0.26
127 0.26
128 0.25
129 0.28
130 0.3
131 0.3
132 0.38
133 0.43
134 0.46
135 0.47
136 0.5
137 0.53
138 0.57
139 0.59
140 0.58
141 0.57
142 0.62
143 0.56
144 0.48
145 0.46
146 0.45
147 0.43
148 0.39
149 0.34
150 0.27
151 0.28
152 0.27