Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A066XDD9

Protein Details
Accession A0A066XDD9    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
20-42TSITTPPKRKGPRHHPEWHRVWGBasic
NLS Segment(s)
PositionSequence
27-31KRKGP
Subcellular Location(s) nucl 10, mito 10, mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR000453  Chorismate_synth  
IPR035904  Chorismate_synth_AroC_sf  
Gene Ontology GO:0004107  F:chorismate synthase activity  
GO:0008652  P:amino acid biosynthetic process  
GO:0009073  P:aromatic amino acid family biosynthetic process  
Pfam View protein in Pfam  
PF01264  Chorismate_synt  
Amino Acid Sequences MALTESDIQLGLNRRRPGQTSITTPPKRKGPRHHPEWHRVWGHLGTPIGMLFRNEDQRPKDYGNSTMDRFPRLSHASWTYLEKYGVKAFSGGGRSSARETIARVAAGNLAENYLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.41
3 0.44
4 0.46
5 0.45
6 0.44
7 0.43
8 0.49
9 0.57
10 0.6
11 0.61
12 0.61
13 0.63
14 0.67
15 0.68
16 0.7
17 0.71
18 0.74
19 0.79
20 0.84
21 0.83
22 0.83
23 0.8
24 0.77
25 0.68
26 0.58
27 0.52
28 0.43
29 0.36
30 0.29
31 0.23
32 0.15
33 0.14
34 0.13
35 0.1
36 0.09
37 0.09
38 0.07
39 0.09
40 0.14
41 0.14
42 0.19
43 0.21
44 0.23
45 0.26
46 0.26
47 0.27
48 0.24
49 0.28
50 0.29
51 0.29
52 0.28
53 0.3
54 0.29
55 0.28
56 0.27
57 0.23
58 0.23
59 0.24
60 0.23
61 0.23
62 0.25
63 0.26
64 0.27
65 0.3
66 0.27
67 0.25
68 0.25
69 0.22
70 0.21
71 0.22
72 0.21
73 0.18
74 0.16
75 0.15
76 0.17
77 0.2
78 0.17
79 0.17
80 0.18
81 0.2
82 0.22
83 0.23
84 0.21
85 0.19
86 0.21
87 0.23
88 0.24
89 0.22
90 0.2
91 0.19
92 0.19
93 0.19
94 0.18
95 0.13