Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A066X3J5

Protein Details
Accession A0A066X3J5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
61-80MIRSNRKKAAKAKAAAKKKAHydrophilic
NLS Segment(s)
PositionSequence
65-80NRKKAAKAKAAAKKKA
Subcellular Location(s) plas 10, mito 6, E.R. 4, cyto 3, extr 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MLVAASVIFTYYSIWTLLMPFVDEGHPLQNFFPARVWAIRIPVILILLGSAVVGSFLGTVMIRSNRKKAAKAKAAAKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.09
5 0.08
6 0.08
7 0.07
8 0.08
9 0.08
10 0.09
11 0.09
12 0.11
13 0.11
14 0.11
15 0.11
16 0.15
17 0.15
18 0.15
19 0.15
20 0.13
21 0.14
22 0.14
23 0.16
24 0.12
25 0.14
26 0.14
27 0.13
28 0.12
29 0.1
30 0.1
31 0.07
32 0.06
33 0.04
34 0.03
35 0.03
36 0.03
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.03
45 0.03
46 0.04
47 0.07
48 0.13
49 0.19
50 0.22
51 0.28
52 0.36
53 0.41
54 0.49
55 0.54
56 0.6
57 0.64
58 0.68
59 0.73
60 0.75