Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A066XK46

Protein Details
Accession A0A066XK46    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
19-41PAAGAKKQKKKSTYPFHRSKGKVHydrophilic
NLS Segment(s)
PositionSequence
6-43SRPLRAKRPHPLAPAAGAKKQKKKSTYPFHRSKGKVKD
Subcellular Location(s) nucl 11, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MVRPASRPLRAKRPHPLAPAAGAKKQKKKSTYPFHRSKGKVKDKAQHAVILDKATSDKLYKDVQSYRLVTVAVLVDRLKINGSLARRCLADLEEKGIIKPVVQHSKMKIYTRAVGGTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.72
3 0.7
4 0.61
5 0.59
6 0.6
7 0.53
8 0.5
9 0.5
10 0.53
11 0.57
12 0.63
13 0.65
14 0.62
15 0.69
16 0.73
17 0.76
18 0.8
19 0.81
20 0.82
21 0.82
22 0.85
23 0.79
24 0.78
25 0.77
26 0.77
27 0.76
28 0.72
29 0.73
30 0.7
31 0.72
32 0.64
33 0.56
34 0.46
35 0.39
36 0.34
37 0.27
38 0.2
39 0.14
40 0.13
41 0.1
42 0.1
43 0.08
44 0.07
45 0.09
46 0.12
47 0.12
48 0.16
49 0.18
50 0.2
51 0.24
52 0.25
53 0.23
54 0.22
55 0.21
56 0.17
57 0.15
58 0.13
59 0.08
60 0.08
61 0.07
62 0.08
63 0.08
64 0.09
65 0.08
66 0.07
67 0.09
68 0.11
69 0.15
70 0.18
71 0.19
72 0.21
73 0.2
74 0.2
75 0.21
76 0.19
77 0.22
78 0.19
79 0.21
80 0.23
81 0.23
82 0.22
83 0.25
84 0.23
85 0.17
86 0.21
87 0.26
88 0.33
89 0.35
90 0.4
91 0.41
92 0.51
93 0.56
94 0.56
95 0.53
96 0.49
97 0.51
98 0.5