Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6QGS1

Protein Details
Accession B6QGS1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKRKKSSRGPQGPKKREPLATBasic
NLS Segment(s)
PositionSequence
3-17KRKKSSRGPQGPKKR
Subcellular Location(s) mito 13.5, cyto_mito 12.5, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
KEGG tmf:PMAA_086390  -  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRGPQGPKKREPLATTFACLFCNHENSITVKLDKKLGLGNLSCKVCGQRFQTGINYLSAAVDVYSDWVDACDAVAKSKANTYDTDEKAVYSRGSPADADLDADL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.86
3 0.81
4 0.76
5 0.69
6 0.65
7 0.61
8 0.53
9 0.48
10 0.43
11 0.37
12 0.32
13 0.27
14 0.25
15 0.2
16 0.22
17 0.2
18 0.18
19 0.2
20 0.2
21 0.25
22 0.23
23 0.22
24 0.21
25 0.22
26 0.24
27 0.22
28 0.21
29 0.19
30 0.19
31 0.2
32 0.18
33 0.2
34 0.23
35 0.23
36 0.22
37 0.19
38 0.2
39 0.18
40 0.22
41 0.22
42 0.21
43 0.23
44 0.25
45 0.27
46 0.27
47 0.27
48 0.22
49 0.19
50 0.14
51 0.12
52 0.1
53 0.08
54 0.05
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.05
62 0.05
63 0.04
64 0.05
65 0.07
66 0.07
67 0.09
68 0.11
69 0.12
70 0.12
71 0.16
72 0.19
73 0.17
74 0.19
75 0.25
76 0.33
77 0.34
78 0.37
79 0.34
80 0.31
81 0.31
82 0.32
83 0.25
84 0.17
85 0.19
86 0.17
87 0.18
88 0.18
89 0.18
90 0.18
91 0.18