Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A066X225

Protein Details
Accession A0A066X225    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-38IGIGKGTPRRKMKRAPARSAADHydrophilic
NLS Segment(s)
PositionSequence
9-37KKLGASARIGIGKGTPRRKMKRAPARSAA
Subcellular Location(s) cyto_nucl 13.166, cyto 13, nucl 12, cyto_mito 8.166, mito_nucl 7.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR039370  BTF3  
IPR038187  NAC_A/B_dom_sf  
IPR002715  Nas_poly-pep-assoc_cplx_dom  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF01849  NAC  
PROSITE View protein in PROSITE  
PS51151  NAC_AB  
CDD cd22055  NAC_BTF3  
Amino Acid Sequences MSDVQERLKKLGASARIGIGKGTPRRKMKRAPARSAADDKKLQAALKKLNVQPIQAIEEVNMFKSDGNVIHFAAPKVHAAVPANTFAIYGNGEDKELTELVPGILNQLGPDSLASLRKLAESYQNMQKEGKDGEEDDIPELVEGENFESKVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.34
4 0.34
5 0.31
6 0.26
7 0.29
8 0.33
9 0.39
10 0.43
11 0.51
12 0.59
13 0.66
14 0.73
15 0.76
16 0.79
17 0.81
18 0.82
19 0.81
20 0.79
21 0.77
22 0.76
23 0.69
24 0.64
25 0.56
26 0.48
27 0.43
28 0.39
29 0.34
30 0.29
31 0.31
32 0.31
33 0.34
34 0.4
35 0.37
36 0.44
37 0.43
38 0.4
39 0.36
40 0.32
41 0.29
42 0.23
43 0.21
44 0.13
45 0.14
46 0.14
47 0.12
48 0.11
49 0.08
50 0.08
51 0.08
52 0.09
53 0.07
54 0.09
55 0.1
56 0.1
57 0.12
58 0.13
59 0.13
60 0.12
61 0.12
62 0.1
63 0.11
64 0.11
65 0.1
66 0.1
67 0.12
68 0.12
69 0.13
70 0.13
71 0.11
72 0.1
73 0.09
74 0.09
75 0.07
76 0.06
77 0.07
78 0.07
79 0.07
80 0.07
81 0.07
82 0.08
83 0.08
84 0.08
85 0.06
86 0.06
87 0.06
88 0.07
89 0.07
90 0.06
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06
96 0.05
97 0.06
98 0.06
99 0.07
100 0.1
101 0.1
102 0.11
103 0.11
104 0.12
105 0.13
106 0.13
107 0.2
108 0.22
109 0.26
110 0.34
111 0.37
112 0.37
113 0.38
114 0.37
115 0.33
116 0.3
117 0.28
118 0.22
119 0.2
120 0.21
121 0.23
122 0.24
123 0.21
124 0.2
125 0.17
126 0.14
127 0.13
128 0.11
129 0.08
130 0.08
131 0.1
132 0.12