Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A066XKX6

Protein Details
Accession A0A066XKX6    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
63-89NGSASGGGRRRRRRNRNRNKQGAENNAHydrophilic
NLS Segment(s)
PositionSequence
69-82GGRRRRRRNRNRNK
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MASVPQPSRRHFPAPPSPSGQSDLTPDQDDILAELGLQVDDSASSAGGSTTGISTIDSGISVNGSASGGGRRRRRRNRNRNKQGAENNAVNINNNGSNGNGNFNKQTTVTIPRQGGGDRDERPVKLKLGLDLDVDLELKAKLKGDICISLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.6
3 0.59
4 0.56
5 0.52
6 0.52
7 0.44
8 0.34
9 0.33
10 0.31
11 0.28
12 0.26
13 0.24
14 0.21
15 0.2
16 0.18
17 0.14
18 0.12
19 0.08
20 0.06
21 0.06
22 0.06
23 0.05
24 0.05
25 0.04
26 0.03
27 0.03
28 0.04
29 0.04
30 0.03
31 0.03
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.03
52 0.03
53 0.04
54 0.07
55 0.11
56 0.18
57 0.26
58 0.35
59 0.46
60 0.57
61 0.68
62 0.76
63 0.84
64 0.89
65 0.92
66 0.94
67 0.94
68 0.88
69 0.85
70 0.81
71 0.76
72 0.69
73 0.59
74 0.49
75 0.41
76 0.37
77 0.28
78 0.22
79 0.16
80 0.12
81 0.11
82 0.1
83 0.08
84 0.1
85 0.1
86 0.15
87 0.14
88 0.15
89 0.16
90 0.16
91 0.17
92 0.16
93 0.17
94 0.15
95 0.21
96 0.23
97 0.27
98 0.27
99 0.27
100 0.28
101 0.27
102 0.26
103 0.23
104 0.25
105 0.22
106 0.28
107 0.3
108 0.3
109 0.33
110 0.34
111 0.32
112 0.31
113 0.31
114 0.29
115 0.29
116 0.3
117 0.27
118 0.24
119 0.23
120 0.19
121 0.18
122 0.13
123 0.1
124 0.09
125 0.09
126 0.1
127 0.1
128 0.13
129 0.15
130 0.19
131 0.22