Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A066XEG5

Protein Details
Accession A0A066XEG5    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
48-81QLKARDPEPAKKNKKKTKKPKKPKTPKGKCLAAEBasic
NLS Segment(s)
PositionSequence
52-75RDPEPAKKNKKKTKKPKKPKTPKG
Subcellular Location(s) extr 13, E.R. 5, vacu 3, cyto 2.5, cyto_nucl 2.5, nucl 1.5
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MRWLSAAVLVFSVTSAACAALDLDTAGQLEARHLEVGGLEAGRLAADQLKARDPEPAKKNKKKTKKPKKPKTPKGKCLAAEQTCSDDDDCCSKSCNADTGTCDKEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.05
9 0.05
10 0.05
11 0.05
12 0.05
13 0.05
14 0.05
15 0.05
16 0.06
17 0.07
18 0.07
19 0.07
20 0.07
21 0.07
22 0.06
23 0.07
24 0.07
25 0.06
26 0.05
27 0.04
28 0.04
29 0.04
30 0.04
31 0.03
32 0.04
33 0.06
34 0.07
35 0.09
36 0.12
37 0.13
38 0.13
39 0.19
40 0.19
41 0.26
42 0.32
43 0.42
44 0.49
45 0.57
46 0.68
47 0.72
48 0.81
49 0.84
50 0.88
51 0.89
52 0.91
53 0.94
54 0.94
55 0.96
56 0.97
57 0.96
58 0.96
59 0.96
60 0.94
61 0.91
62 0.87
63 0.78
64 0.75
65 0.74
66 0.65
67 0.58
68 0.5
69 0.45
70 0.37
71 0.36
72 0.29
73 0.2
74 0.18
75 0.2
76 0.2
77 0.17
78 0.2
79 0.19
80 0.23
81 0.24
82 0.28
83 0.26
84 0.28
85 0.32
86 0.35