Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A066X7G1

Protein Details
Accession A0A066X7G1    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
50-75QSKHASKKSSGKKKGSKRSGQQYVPSHydrophilic
NLS Segment(s)
PositionSequence
51-67SKHASKKSSGKKKGSKR
Subcellular Location(s) nucl 15.5, cyto_nucl 14.5, cyto 6.5, mito 5
Family & Domain DBs
Amino Acid Sequences MDSGNSYGGGGSSSGGGSSSKGTSPDDGSKTYDQYAIFDGLLPRIETRGQSKHASKKSSGKKKGSKRSGQQYVPSIKKQNGQSLTFSRTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.07
5 0.08
6 0.09
7 0.1
8 0.11
9 0.13
10 0.14
11 0.18
12 0.23
13 0.24
14 0.24
15 0.28
16 0.28
17 0.28
18 0.27
19 0.25
20 0.19
21 0.18
22 0.18
23 0.15
24 0.13
25 0.12
26 0.12
27 0.1
28 0.1
29 0.09
30 0.08
31 0.07
32 0.08
33 0.08
34 0.12
35 0.15
36 0.18
37 0.23
38 0.29
39 0.37
40 0.43
41 0.45
42 0.45
43 0.51
44 0.58
45 0.64
46 0.67
47 0.68
48 0.72
49 0.79
50 0.86
51 0.86
52 0.85
53 0.84
54 0.85
55 0.85
56 0.8
57 0.76
58 0.73
59 0.72
60 0.69
61 0.65
62 0.61
63 0.55
64 0.57
65 0.56
66 0.57
67 0.54
68 0.51
69 0.52
70 0.51