Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067T7S0

Protein Details
Accession A0A067T7S0    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
44-67EEERQKWARERREKEDKERRDQDEAcidic
NLS Segment(s)
PositionSequence
52-58RERREKE
Subcellular Location(s) nucl 10, mito 9, cyto 7
Family & Domain DBs
Amino Acid Sequences MPLNRRWHDSLRRQRADEEHSWAVAREAWAVEAQEHETKRVAMEEERQKWARERREKEDKERRDQDEEAKKRADIAWVGLEAGHCLRYRVKEYKATLSHVPLGVDGLQECWNKSIEMHGKKWPPSQCEDEGLCGRVTGHWQIDINEPSCTPWWSYPINRGCAESGYRRYDARLENFPDTTDWPVICNSAPANISGTWYDRPTSCEHLQRDGIWGKWLINDSNCR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.72
3 0.69
4 0.63
5 0.59
6 0.5
7 0.44
8 0.42
9 0.36
10 0.3
11 0.25
12 0.2
13 0.14
14 0.12
15 0.12
16 0.13
17 0.13
18 0.12
19 0.12
20 0.14
21 0.18
22 0.18
23 0.19
24 0.19
25 0.19
26 0.19
27 0.2
28 0.19
29 0.16
30 0.25
31 0.33
32 0.37
33 0.43
34 0.44
35 0.44
36 0.5
37 0.56
38 0.57
39 0.58
40 0.61
41 0.63
42 0.73
43 0.77
44 0.8
45 0.82
46 0.8
47 0.79
48 0.81
49 0.76
50 0.71
51 0.67
52 0.65
53 0.65
54 0.62
55 0.56
56 0.49
57 0.44
58 0.4
59 0.38
60 0.31
61 0.21
62 0.19
63 0.16
64 0.14
65 0.15
66 0.13
67 0.12
68 0.1
69 0.1
70 0.09
71 0.07
72 0.08
73 0.11
74 0.13
75 0.19
76 0.24
77 0.28
78 0.33
79 0.36
80 0.43
81 0.43
82 0.44
83 0.39
84 0.36
85 0.34
86 0.28
87 0.25
88 0.16
89 0.15
90 0.11
91 0.1
92 0.07
93 0.07
94 0.11
95 0.11
96 0.11
97 0.11
98 0.12
99 0.11
100 0.11
101 0.16
102 0.2
103 0.24
104 0.27
105 0.32
106 0.35
107 0.38
108 0.44
109 0.42
110 0.37
111 0.37
112 0.4
113 0.36
114 0.36
115 0.34
116 0.31
117 0.28
118 0.27
119 0.22
120 0.16
121 0.15
122 0.11
123 0.12
124 0.12
125 0.11
126 0.11
127 0.12
128 0.13
129 0.19
130 0.21
131 0.2
132 0.18
133 0.17
134 0.17
135 0.18
136 0.17
137 0.14
138 0.13
139 0.15
140 0.19
141 0.21
142 0.29
143 0.33
144 0.37
145 0.36
146 0.36
147 0.33
148 0.31
149 0.33
150 0.3
151 0.31
152 0.31
153 0.32
154 0.3
155 0.31
156 0.35
157 0.37
158 0.36
159 0.37
160 0.38
161 0.39
162 0.39
163 0.39
164 0.34
165 0.3
166 0.29
167 0.24
168 0.19
169 0.17
170 0.17
171 0.17
172 0.16
173 0.16
174 0.12
175 0.14
176 0.14
177 0.13
178 0.16
179 0.14
180 0.16
181 0.16
182 0.19
183 0.18
184 0.19
185 0.21
186 0.19
187 0.22
188 0.25
189 0.31
190 0.34
191 0.4
192 0.41
193 0.46
194 0.48
195 0.45
196 0.48
197 0.44
198 0.4
199 0.35
200 0.33
201 0.28
202 0.29
203 0.31
204 0.28