Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067SS85

Protein Details
Accession A0A067SS85    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
35-56QYQSRATKRGARRTRVKAHRTVHydrophilic
NLS Segment(s)
PositionSequence
42-53KRGARRTRVKAH
Subcellular Location(s) mito 9, nucl 8, cyto 6, plas 3
Family & Domain DBs
Amino Acid Sequences MTVLHGTPVHESGSSRASPFFSASQFEPLLHPISQYQSRATKRGARRTRVKAHRTVSPSPRLRASTNLKAPLSIDQALYPPMVDTYAFSFWMDFWNAVALAEWTPPFPLRSRDFMPVHIPCMILEHNVEFYKLPFIQCIAVRTSAPSDFPRTFRVPSLVARNLFAHLGQEVSLSRNCTGSVIVWPSRSHAFMAVLSGTPVHESGSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.2
4 0.2
5 0.21
6 0.23
7 0.23
8 0.19
9 0.21
10 0.22
11 0.25
12 0.24
13 0.23
14 0.22
15 0.21
16 0.23
17 0.2
18 0.19
19 0.15
20 0.21
21 0.24
22 0.24
23 0.27
24 0.32
25 0.36
26 0.39
27 0.42
28 0.45
29 0.5
30 0.59
31 0.63
32 0.64
33 0.71
34 0.76
35 0.82
36 0.84
37 0.82
38 0.79
39 0.74
40 0.72
41 0.69
42 0.67
43 0.64
44 0.64
45 0.62
46 0.56
47 0.57
48 0.52
49 0.47
50 0.47
51 0.48
52 0.47
53 0.47
54 0.51
55 0.46
56 0.43
57 0.42
58 0.38
59 0.33
60 0.25
61 0.2
62 0.14
63 0.15
64 0.15
65 0.14
66 0.11
67 0.07
68 0.06
69 0.06
70 0.05
71 0.05
72 0.07
73 0.08
74 0.09
75 0.08
76 0.08
77 0.08
78 0.1
79 0.1
80 0.07
81 0.06
82 0.07
83 0.07
84 0.06
85 0.07
86 0.05
87 0.05
88 0.06
89 0.06
90 0.05
91 0.06
92 0.06
93 0.07
94 0.08
95 0.13
96 0.15
97 0.2
98 0.23
99 0.29
100 0.3
101 0.31
102 0.35
103 0.31
104 0.3
105 0.26
106 0.23
107 0.16
108 0.18
109 0.16
110 0.11
111 0.1
112 0.09
113 0.11
114 0.11
115 0.12
116 0.09
117 0.09
118 0.13
119 0.13
120 0.13
121 0.11
122 0.12
123 0.14
124 0.15
125 0.17
126 0.15
127 0.15
128 0.15
129 0.16
130 0.18
131 0.15
132 0.17
133 0.17
134 0.21
135 0.22
136 0.24
137 0.29
138 0.3
139 0.31
140 0.3
141 0.32
142 0.28
143 0.3
144 0.36
145 0.36
146 0.34
147 0.34
148 0.33
149 0.3
150 0.28
151 0.24
152 0.17
153 0.11
154 0.11
155 0.09
156 0.09
157 0.08
158 0.11
159 0.13
160 0.14
161 0.15
162 0.15
163 0.15
164 0.15
165 0.15
166 0.13
167 0.17
168 0.2
169 0.22
170 0.24
171 0.24
172 0.27
173 0.29
174 0.29
175 0.24
176 0.21
177 0.2
178 0.18
179 0.21
180 0.18
181 0.16
182 0.15
183 0.14
184 0.12
185 0.11
186 0.11