Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067S6S0

Protein Details
Accession A0A067S6S0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
74-93IGCGVEKKPRRTPAKRGGGHBasic
NLS Segment(s)
PositionSequence
80-92KKPRRTPAKRGGG
Subcellular Location(s) mito 23, cyto_mito 13
Family & Domain DBs
Amino Acid Sequences MLLSARAWSFPLKNRLTYRGRQIDDRGCSLAIRQIIGWLSTIFRPKRGSDGKGKKILVFWADVDVGEEQEARNIGCGVEKKPRRTPAKRGGGHIRVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.54
3 0.56
4 0.58
5 0.6
6 0.6
7 0.59
8 0.56
9 0.59
10 0.58
11 0.55
12 0.52
13 0.43
14 0.34
15 0.31
16 0.27
17 0.24
18 0.17
19 0.14
20 0.11
21 0.11
22 0.11
23 0.12
24 0.12
25 0.08
26 0.09
27 0.1
28 0.17
29 0.15
30 0.18
31 0.2
32 0.2
33 0.28
34 0.31
35 0.33
36 0.37
37 0.47
38 0.51
39 0.55
40 0.55
41 0.48
42 0.44
43 0.43
44 0.33
45 0.25
46 0.18
47 0.14
48 0.13
49 0.12
50 0.12
51 0.1
52 0.09
53 0.08
54 0.08
55 0.06
56 0.07
57 0.08
58 0.06
59 0.07
60 0.07
61 0.07
62 0.11
63 0.14
64 0.16
65 0.26
66 0.33
67 0.39
68 0.48
69 0.57
70 0.64
71 0.69
72 0.76
73 0.77
74 0.81
75 0.79
76 0.78
77 0.79