Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6Q6Y6

Protein Details
Accession B6Q6Y6    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
170-199IEKMSLESEKKKKQKKVQEKEERKEKDEGRBasic
NLS Segment(s)
PositionSequence
179-195KKKKQKKVQEKEERKEK
Subcellular Location(s) nucl 12.5, mito 11.5, cyto_nucl 8.333, cyto_mito 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000456  Ribosomal_L17  
IPR036373  Ribosomal_L17_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG tmf:PMAA_025310  -  
Pfam View protein in Pfam  
PF01196  Ribosomal_L17  
PROSITE View protein in PROSITE  
PS01167  RIBOSOMAL_L17  
Amino Acid Sequences MAGGAAKFRHLSRKSSHRQALLRNLVTSLIKHESITTTWPKAKEAQRLAEKLITLGKRNTEHARRRAQSIFYTPHDLLPKLFGPLRERYAERQGGYTRVLRVEPKKDDQAPSAILELVDGPKDMRFAITAKAIARQREQGIQTLNELTALNVRKVTRFRKDGVETLEKEIEKMSLESEKKKKQKKVQEKEERKEKDEGRWDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.66
3 0.71
4 0.69
5 0.72
6 0.75
7 0.76
8 0.75
9 0.68
10 0.58
11 0.51
12 0.45
13 0.4
14 0.32
15 0.27
16 0.21
17 0.19
18 0.19
19 0.19
20 0.19
21 0.19
22 0.25
23 0.25
24 0.26
25 0.3
26 0.31
27 0.32
28 0.38
29 0.43
30 0.47
31 0.48
32 0.51
33 0.54
34 0.55
35 0.56
36 0.5
37 0.43
38 0.35
39 0.35
40 0.28
41 0.24
42 0.24
43 0.27
44 0.26
45 0.31
46 0.38
47 0.41
48 0.48
49 0.53
50 0.61
51 0.58
52 0.61
53 0.6
54 0.55
55 0.5
56 0.47
57 0.44
58 0.36
59 0.4
60 0.35
61 0.35
62 0.34
63 0.3
64 0.24
65 0.22
66 0.2
67 0.16
68 0.18
69 0.16
70 0.18
71 0.21
72 0.24
73 0.24
74 0.25
75 0.27
76 0.32
77 0.33
78 0.3
79 0.3
80 0.28
81 0.27
82 0.27
83 0.25
84 0.19
85 0.17
86 0.17
87 0.18
88 0.21
89 0.25
90 0.27
91 0.29
92 0.33
93 0.34
94 0.35
95 0.32
96 0.31
97 0.26
98 0.23
99 0.2
100 0.15
101 0.12
102 0.1
103 0.09
104 0.07
105 0.06
106 0.05
107 0.05
108 0.05
109 0.06
110 0.06
111 0.06
112 0.06
113 0.07
114 0.09
115 0.1
116 0.12
117 0.12
118 0.18
119 0.21
120 0.23
121 0.24
122 0.26
123 0.26
124 0.29
125 0.3
126 0.28
127 0.28
128 0.26
129 0.26
130 0.23
131 0.21
132 0.16
133 0.15
134 0.12
135 0.14
136 0.15
137 0.14
138 0.16
139 0.17
140 0.2
141 0.27
142 0.35
143 0.38
144 0.41
145 0.43
146 0.49
147 0.53
148 0.54
149 0.54
150 0.55
151 0.48
152 0.49
153 0.51
154 0.42
155 0.38
156 0.33
157 0.27
158 0.2
159 0.18
160 0.15
161 0.18
162 0.22
163 0.31
164 0.39
165 0.49
166 0.57
167 0.66
168 0.74
169 0.76
170 0.84
171 0.87
172 0.89
173 0.9
174 0.92
175 0.94
176 0.94
177 0.94
178 0.9
179 0.83
180 0.81
181 0.73
182 0.72