Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067SW90

Protein Details
Accession A0A067SW90    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
277-302QSKTGSKPVPTDKKRKATAKPSQGVEHydrophilic
NLS Segment(s)
PositionSequence
287-297TDKKRKATAKP
Subcellular Location(s) nucl 13.5, cyto_nucl 11.833, mito_nucl 9.666, cyto 8, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040456  RNase_H2_suB  
IPR019024  RNase_H2_suB_wHTH  
IPR041195  Rnh202_N  
Gene Ontology GO:0005634  C:nucleus  
GO:0032299  C:ribonuclease H2 complex  
Pfam View protein in Pfam  
PF09468  RNase_H2-Ydr279  
PF17745  Ydr279_N  
CDD cd09270  RNase_H2-B  
Amino Acid Sequences MNSHFSILPSAIIQYLTSSLNQTEIEEKPLRIFRLPHPRTGFPALFLPLEWLPPSMADSSTLLEIQAVCPPDERSWILGEDIIADGKLFAMTPIDPAFLLLPILQATQAVDGSTAQFRTTDDLFEEAAKKITSPGGPAAQVRDILDFCSLKGTRKALVCLCDMKEISSEIVVYRFSAHKAMEYMRDKVARLQKCPAFDRSRTTIRSLAKDGLLEDGKEDLLQLGRMRACCDLVSQYLSPDIRDQLVDSYDFKKLDTYLNASMEEAITKTGVAPPKVQSKTGSKPVPTDKKRKATAKPSQGVEKLKKVNTTGMAKLSSFFNKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.12
4 0.12
5 0.13
6 0.13
7 0.15
8 0.15
9 0.15
10 0.18
11 0.18
12 0.24
13 0.26
14 0.26
15 0.3
16 0.34
17 0.35
18 0.34
19 0.37
20 0.39
21 0.47
22 0.49
23 0.52
24 0.54
25 0.54
26 0.56
27 0.6
28 0.51
29 0.42
30 0.43
31 0.36
32 0.3
33 0.27
34 0.26
35 0.18
36 0.19
37 0.17
38 0.14
39 0.12
40 0.12
41 0.14
42 0.11
43 0.11
44 0.11
45 0.12
46 0.12
47 0.13
48 0.13
49 0.11
50 0.1
51 0.1
52 0.09
53 0.12
54 0.11
55 0.11
56 0.12
57 0.15
58 0.15
59 0.18
60 0.19
61 0.17
62 0.18
63 0.19
64 0.18
65 0.16
66 0.15
67 0.12
68 0.11
69 0.09
70 0.07
71 0.06
72 0.06
73 0.05
74 0.05
75 0.04
76 0.04
77 0.05
78 0.05
79 0.07
80 0.08
81 0.08
82 0.08
83 0.08
84 0.09
85 0.07
86 0.08
87 0.06
88 0.06
89 0.06
90 0.06
91 0.05
92 0.05
93 0.05
94 0.06
95 0.06
96 0.05
97 0.05
98 0.05
99 0.07
100 0.08
101 0.08
102 0.07
103 0.08
104 0.08
105 0.11
106 0.12
107 0.11
108 0.1
109 0.11
110 0.12
111 0.13
112 0.14
113 0.11
114 0.12
115 0.11
116 0.1
117 0.1
118 0.12
119 0.11
120 0.11
121 0.13
122 0.13
123 0.14
124 0.15
125 0.15
126 0.14
127 0.14
128 0.13
129 0.12
130 0.11
131 0.1
132 0.12
133 0.1
134 0.09
135 0.15
136 0.15
137 0.15
138 0.18
139 0.19
140 0.2
141 0.21
142 0.25
143 0.21
144 0.23
145 0.22
146 0.22
147 0.21
148 0.2
149 0.19
150 0.17
151 0.15
152 0.13
153 0.12
154 0.09
155 0.09
156 0.06
157 0.07
158 0.06
159 0.06
160 0.07
161 0.07
162 0.08
163 0.1
164 0.1
165 0.1
166 0.12
167 0.13
168 0.19
169 0.21
170 0.23
171 0.24
172 0.25
173 0.25
174 0.29
175 0.36
176 0.32
177 0.32
178 0.37
179 0.37
180 0.4
181 0.43
182 0.44
183 0.41
184 0.39
185 0.43
186 0.41
187 0.45
188 0.43
189 0.43
190 0.42
191 0.4
192 0.42
193 0.39
194 0.35
195 0.29
196 0.28
197 0.25
198 0.23
199 0.2
200 0.16
201 0.13
202 0.12
203 0.11
204 0.1
205 0.1
206 0.06
207 0.06
208 0.08
209 0.08
210 0.11
211 0.13
212 0.14
213 0.15
214 0.15
215 0.16
216 0.15
217 0.16
218 0.14
219 0.14
220 0.17
221 0.16
222 0.16
223 0.19
224 0.19
225 0.18
226 0.18
227 0.17
228 0.15
229 0.15
230 0.15
231 0.13
232 0.14
233 0.15
234 0.15
235 0.16
236 0.19
237 0.19
238 0.19
239 0.18
240 0.18
241 0.21
242 0.22
243 0.25
244 0.26
245 0.28
246 0.28
247 0.27
248 0.26
249 0.21
250 0.18
251 0.13
252 0.09
253 0.07
254 0.07
255 0.07
256 0.11
257 0.16
258 0.17
259 0.2
260 0.24
261 0.34
262 0.36
263 0.38
264 0.38
265 0.42
266 0.48
267 0.55
268 0.56
269 0.49
270 0.54
271 0.63
272 0.69
273 0.69
274 0.72
275 0.72
276 0.75
277 0.82
278 0.84
279 0.83
280 0.83
281 0.85
282 0.85
283 0.82
284 0.78
285 0.77
286 0.75
287 0.75
288 0.71
289 0.69
290 0.66
291 0.63
292 0.63
293 0.57
294 0.57
295 0.55
296 0.54
297 0.49
298 0.46
299 0.44
300 0.4
301 0.39
302 0.37