Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067SEV0

Protein Details
Accession A0A067SEV0   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
126-169RPETRLQPTTKPKRPWKYKYPLRPRDPRKTRHKIPYIRPRPRPVBasic
NLS Segment(s)
PositionSequence
120-167RPRPRPRPETRLQPTTKPKRPWKYKYPLRPRDPRKTRHKIPYIRPRPR
Subcellular Location(s) nucl 12.5, cyto_nucl 9, mito 6, cyto 4.5, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLRARTKASDPSEWRAPVLNADVDVDEDKNAFKPKRRRVSTTLWQVYLLQTRLRTRLFFLLATFLLVLYGYMRFEPGLRPSDSSLAANSTLESQTAVLANASDSKTYSAATEVDIDATPRPRPRPRPETRLQPTTKPKRPWKYKYPLRPRDPRKTRHKIPYIRPRPRPVVIPSSTPTQRLVEAAYRTGIPKPKRRPAASALVLSGGSEAPSPPPSPPPSLSPQPSSSSQPAAPLLLNMGRAGTGVGTGIDIDVESP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.47
3 0.42
4 0.36
5 0.34
6 0.28
7 0.2
8 0.21
9 0.2
10 0.18
11 0.18
12 0.15
13 0.12
14 0.11
15 0.11
16 0.14
17 0.22
18 0.24
19 0.32
20 0.42
21 0.52
22 0.63
23 0.69
24 0.73
25 0.72
26 0.78
27 0.79
28 0.8
29 0.75
30 0.65
31 0.59
32 0.52
33 0.48
34 0.44
35 0.35
36 0.27
37 0.26
38 0.28
39 0.32
40 0.33
41 0.31
42 0.28
43 0.32
44 0.31
45 0.28
46 0.25
47 0.23
48 0.21
49 0.2
50 0.17
51 0.11
52 0.09
53 0.08
54 0.07
55 0.05
56 0.05
57 0.05
58 0.05
59 0.06
60 0.06
61 0.07
62 0.09
63 0.13
64 0.17
65 0.17
66 0.19
67 0.2
68 0.23
69 0.23
70 0.21
71 0.18
72 0.15
73 0.14
74 0.12
75 0.11
76 0.1
77 0.09
78 0.09
79 0.08
80 0.07
81 0.07
82 0.07
83 0.07
84 0.05
85 0.05
86 0.05
87 0.08
88 0.08
89 0.08
90 0.08
91 0.09
92 0.09
93 0.09
94 0.09
95 0.08
96 0.08
97 0.08
98 0.09
99 0.08
100 0.09
101 0.08
102 0.09
103 0.09
104 0.1
105 0.12
106 0.14
107 0.19
108 0.25
109 0.34
110 0.42
111 0.52
112 0.57
113 0.64
114 0.66
115 0.71
116 0.71
117 0.71
118 0.64
119 0.62
120 0.65
121 0.67
122 0.69
123 0.67
124 0.71
125 0.72
126 0.8
127 0.81
128 0.8
129 0.81
130 0.82
131 0.84
132 0.86
133 0.86
134 0.84
135 0.86
136 0.84
137 0.85
138 0.85
139 0.83
140 0.83
141 0.83
142 0.83
143 0.83
144 0.84
145 0.82
146 0.83
147 0.85
148 0.85
149 0.85
150 0.84
151 0.8
152 0.76
153 0.7
154 0.65
155 0.59
156 0.56
157 0.49
158 0.46
159 0.41
160 0.42
161 0.4
162 0.36
163 0.33
164 0.25
165 0.24
166 0.2
167 0.2
168 0.19
169 0.19
170 0.19
171 0.18
172 0.17
173 0.18
174 0.21
175 0.26
176 0.28
177 0.37
178 0.45
179 0.54
180 0.62
181 0.64
182 0.66
183 0.65
184 0.68
185 0.63
186 0.55
187 0.47
188 0.38
189 0.35
190 0.29
191 0.23
192 0.13
193 0.09
194 0.07
195 0.07
196 0.08
197 0.1
198 0.11
199 0.12
200 0.19
201 0.22
202 0.27
203 0.29
204 0.32
205 0.37
206 0.45
207 0.48
208 0.47
209 0.47
210 0.46
211 0.47
212 0.48
213 0.44
214 0.4
215 0.36
216 0.34
217 0.32
218 0.29
219 0.26
220 0.2
221 0.2
222 0.17
223 0.17
224 0.14
225 0.13
226 0.11
227 0.11
228 0.11
229 0.07
230 0.06
231 0.05
232 0.05
233 0.05
234 0.05
235 0.05
236 0.05