Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067SLA2

Protein Details
Accession A0A067SLA2    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
59-89DDDGRKRRGGSLRRRRRRRGRRDERRWASRVBasic
NLS Segment(s)
PositionSequence
63-88RKRRGGSLRRRRRRRGRRDERRWASR
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, cyto 4.5, mito 4
Family & Domain DBs
Amino Acid Sequences MRLSISRLSSEGGVGLEDELGKGLLHFADGPRFDYEPFIREYLQRAHQEGLLNALLDRDDDGRKRRGGSLRRRRRRRGRRDERRWASRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.07
4 0.06
5 0.06
6 0.05
7 0.05
8 0.05
9 0.04
10 0.05
11 0.04
12 0.05
13 0.06
14 0.06
15 0.1
16 0.11
17 0.14
18 0.15
19 0.16
20 0.15
21 0.19
22 0.19
23 0.16
24 0.17
25 0.16
26 0.15
27 0.15
28 0.18
29 0.18
30 0.24
31 0.23
32 0.23
33 0.22
34 0.24
35 0.24
36 0.21
37 0.2
38 0.14
39 0.13
40 0.11
41 0.1
42 0.08
43 0.07
44 0.08
45 0.07
46 0.1
47 0.14
48 0.18
49 0.23
50 0.26
51 0.28
52 0.33
53 0.4
54 0.47
55 0.55
56 0.62
57 0.68
58 0.77
59 0.85
60 0.9
61 0.92
62 0.94
63 0.94
64 0.94
65 0.95
66 0.95
67 0.96
68 0.96
69 0.95