Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067TLV9

Protein Details
Accession A0A067TLV9    Localization Confidence High Confidence Score 20.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-64MDAMLSKEDQKRQRRKIRYLANIESEREKARTRARRNKQALRDPDEIKRRKECHRQAQARYRAAHydrophilic
72-92QAWQHRLKAKREKTREKELQGHydrophilic
NLS Segment(s)
PositionSequence
12-52RQRRKIRYLANIESEREKARTRARRNKQALRDPDEIKRRKE
77-84RLKAKREK
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MDAMLSKEDQKRQRRKIRYLANIESEREKARTRARRNKQALRDPDEIKRRKECHRQAQARYRAANRAQLRTQAWQHRLKAKREKTREKELQGDEEEYQALMAQVLEDEDNEFEAKREKTCEKELQGVEDEDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.85
3 0.87
4 0.88
5 0.88
6 0.86
7 0.82
8 0.8
9 0.73
10 0.66
11 0.59
12 0.51
13 0.43
14 0.37
15 0.32
16 0.3
17 0.37
18 0.44
19 0.52
20 0.61
21 0.68
22 0.76
23 0.84
24 0.87
25 0.86
26 0.86
27 0.83
28 0.8
29 0.76
30 0.68
31 0.67
32 0.67
33 0.62
34 0.58
35 0.58
36 0.55
37 0.57
38 0.65
39 0.66
40 0.67
41 0.73
42 0.77
43 0.77
44 0.83
45 0.82
46 0.76
47 0.7
48 0.61
49 0.56
50 0.49
51 0.48
52 0.41
53 0.37
54 0.33
55 0.34
56 0.34
57 0.32
58 0.36
59 0.35
60 0.39
61 0.4
62 0.42
63 0.47
64 0.52
65 0.56
66 0.61
67 0.63
68 0.67
69 0.72
70 0.79
71 0.77
72 0.82
73 0.81
74 0.75
75 0.74
76 0.67
77 0.62
78 0.53
79 0.49
80 0.39
81 0.31
82 0.27
83 0.18
84 0.16
85 0.1
86 0.08
87 0.05
88 0.04
89 0.04
90 0.04
91 0.04
92 0.05
93 0.05
94 0.06
95 0.06
96 0.07
97 0.07
98 0.08
99 0.08
100 0.14
101 0.15
102 0.17
103 0.23
104 0.27
105 0.32
106 0.4
107 0.48
108 0.47
109 0.55
110 0.54
111 0.53
112 0.51