Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067SHT4

Protein Details
Accession A0A067SHT4    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-26KTESRSSRKIGPREKGRRIVVBasic
NLS Segment(s)
PositionSequence
14-21KIGPREKG
Subcellular Location(s) mito 11, cyto 9.5, cyto_pero 6, nucl 5
Family & Domain DBs
Amino Acid Sequences MDAMIKTESRSSRKIGPREKGRRIVVGLPVNDKVTRDIEFPVDIPYLDFCDRIMAALGVDPASAVLGWKTSNKGKRAAAHELGKDLDMEHAFNTILNIQDNRYFGGETPSRYRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.62
3 0.66
4 0.72
5 0.79
6 0.84
7 0.83
8 0.77
9 0.72
10 0.66
11 0.6
12 0.56
13 0.52
14 0.45
15 0.39
16 0.37
17 0.34
18 0.31
19 0.28
20 0.22
21 0.18
22 0.18
23 0.16
24 0.15
25 0.15
26 0.15
27 0.15
28 0.15
29 0.13
30 0.11
31 0.11
32 0.1
33 0.11
34 0.11
35 0.11
36 0.08
37 0.09
38 0.09
39 0.09
40 0.09
41 0.05
42 0.05
43 0.05
44 0.06
45 0.04
46 0.04
47 0.04
48 0.03
49 0.03
50 0.03
51 0.03
52 0.02
53 0.03
54 0.04
55 0.05
56 0.09
57 0.15
58 0.22
59 0.24
60 0.3
61 0.33
62 0.39
63 0.44
64 0.48
65 0.48
66 0.47
67 0.46
68 0.42
69 0.39
70 0.33
71 0.27
72 0.2
73 0.17
74 0.12
75 0.12
76 0.1
77 0.1
78 0.1
79 0.1
80 0.11
81 0.09
82 0.1
83 0.12
84 0.12
85 0.14
86 0.17
87 0.18
88 0.19
89 0.19
90 0.18
91 0.16
92 0.24
93 0.25
94 0.27