Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067SDD2

Protein Details
Accession A0A067SDD2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
85-104KNWRVFCPGRHIRRRPAQSGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
Amino Acid Sequences MTLTLMLWWLMRRQARQLRRAYYFLLKALLRTVFAASMGCPNKLTGEILPEYPKEGEEWPLKTDSDEKAMRFCWDQPYSFASNWKNWRVFCPGRHIRRRPAQSGYMEVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.5
3 0.57
4 0.63
5 0.64
6 0.64
7 0.64
8 0.59
9 0.55
10 0.49
11 0.42
12 0.38
13 0.31
14 0.26
15 0.27
16 0.23
17 0.17
18 0.15
19 0.15
20 0.1
21 0.1
22 0.1
23 0.07
24 0.14
25 0.15
26 0.14
27 0.14
28 0.14
29 0.14
30 0.15
31 0.16
32 0.09
33 0.11
34 0.11
35 0.12
36 0.13
37 0.13
38 0.14
39 0.12
40 0.12
41 0.1
42 0.1
43 0.13
44 0.15
45 0.17
46 0.17
47 0.18
48 0.18
49 0.17
50 0.2
51 0.16
52 0.19
53 0.2
54 0.19
55 0.2
56 0.21
57 0.22
58 0.21
59 0.21
60 0.24
61 0.24
62 0.24
63 0.24
64 0.29
65 0.31
66 0.3
67 0.34
68 0.29
69 0.34
70 0.4
71 0.45
72 0.44
73 0.41
74 0.44
75 0.47
76 0.5
77 0.46
78 0.5
79 0.53
80 0.6
81 0.69
82 0.73
83 0.74
84 0.78
85 0.83
86 0.78
87 0.75
88 0.72
89 0.66