Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067TKI9

Protein Details
Accession A0A067TKI9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
40-60FHPCCCSHWRRFRPHRAGQTGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, cyto_mito 8.5, extr 7, cyto 2.5, pero 2
Family & Domain DBs
Amino Acid Sequences MRRQNFSCALPLVSCWSPLKSTFIQPPKLFCNYYACLLSFHPCCCSHWRRFRPHRAGQTGRLRFHRPVSLSNMPSEGSLGPYEGVGRSQQVPCHCRLLGQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.21
3 0.2
4 0.2
5 0.21
6 0.26
7 0.23
8 0.27
9 0.34
10 0.39
11 0.45
12 0.45
13 0.47
14 0.46
15 0.48
16 0.44
17 0.36
18 0.36
19 0.3
20 0.31
21 0.28
22 0.24
23 0.21
24 0.21
25 0.24
26 0.19
27 0.18
28 0.18
29 0.18
30 0.2
31 0.26
32 0.31
33 0.36
34 0.45
35 0.53
36 0.6
37 0.69
38 0.77
39 0.79
40 0.8
41 0.8
42 0.78
43 0.74
44 0.72
45 0.73
46 0.69
47 0.63
48 0.59
49 0.55
50 0.48
51 0.48
52 0.45
53 0.36
54 0.34
55 0.38
56 0.41
57 0.39
58 0.37
59 0.35
60 0.29
61 0.27
62 0.25
63 0.17
64 0.11
65 0.1
66 0.1
67 0.09
68 0.08
69 0.09
70 0.08
71 0.09
72 0.08
73 0.11
74 0.14
75 0.17
76 0.21
77 0.28
78 0.31
79 0.34
80 0.39
81 0.36