Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067SVA9

Protein Details
Accession A0A067SVA9    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MTKLRDRERKRMMNRRLRVRGDVBasic
85-119TITLSRDGRDKRKRRRPQKRRGRYRTGRERKLQVEBasic
NLS Segment(s)
PositionSequence
92-115GRDKRKRRRPQKRRGRYRTGRERK
Subcellular Location(s) mito 22, nucl 2, cyto 1, extr 1, pero 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MTKLRDRERKRMMNRRLRVRGDVAWAGGFWTGGLLRFVRVANACGWRLASTKWLLGWLWAELAASQVEVVAESGREARCEHTRTTITLSRDGRDKRKRRRPQKRRGRYRTGRERKLQVENMMTLSSRGFMADKKAAGVEFEVEGMWEEAAGGRPHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.9
3 0.89
4 0.83
5 0.78
6 0.72
7 0.64
8 0.6
9 0.52
10 0.42
11 0.33
12 0.28
13 0.23
14 0.18
15 0.14
16 0.08
17 0.07
18 0.06
19 0.06
20 0.08
21 0.07
22 0.08
23 0.09
24 0.1
25 0.12
26 0.12
27 0.13
28 0.16
29 0.19
30 0.19
31 0.18
32 0.19
33 0.17
34 0.18
35 0.17
36 0.17
37 0.15
38 0.15
39 0.15
40 0.15
41 0.14
42 0.13
43 0.14
44 0.1
45 0.08
46 0.08
47 0.07
48 0.06
49 0.07
50 0.05
51 0.04
52 0.04
53 0.04
54 0.03
55 0.04
56 0.04
57 0.03
58 0.03
59 0.03
60 0.06
61 0.06
62 0.07
63 0.08
64 0.1
65 0.15
66 0.18
67 0.18
68 0.21
69 0.22
70 0.22
71 0.27
72 0.29
73 0.26
74 0.31
75 0.31
76 0.27
77 0.33
78 0.36
79 0.41
80 0.47
81 0.55
82 0.59
83 0.69
84 0.79
85 0.84
86 0.91
87 0.92
88 0.93
89 0.95
90 0.95
91 0.95
92 0.94
93 0.94
94 0.92
95 0.92
96 0.92
97 0.92
98 0.89
99 0.85
100 0.83
101 0.77
102 0.76
103 0.7
104 0.63
105 0.55
106 0.48
107 0.42
108 0.36
109 0.3
110 0.22
111 0.17
112 0.13
113 0.09
114 0.09
115 0.08
116 0.09
117 0.15
118 0.18
119 0.18
120 0.19
121 0.2
122 0.19
123 0.19
124 0.19
125 0.14
126 0.11
127 0.11
128 0.1
129 0.09
130 0.1
131 0.09
132 0.08
133 0.06
134 0.06
135 0.07
136 0.11