Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067T926

Protein Details
Accession A0A067T926    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
28-52LCVNCCHNCGRRRRWRFNVQHSTLSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 17, mito 5, extr 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVSEIPETILAPSALSAGTVAAISTVCLCVNCCHNCGRRRRWRFNVQHSTLSSRRTDLWRKFSLADLTGSPTENSERSHSGLMVLVYLPADACSASAPLLSLLPLFVVYDLCSGYPGIFRQRWRDVSRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.04
5 0.05
6 0.05
7 0.04
8 0.04
9 0.04
10 0.04
11 0.05
12 0.06
13 0.05
14 0.06
15 0.07
16 0.09
17 0.16
18 0.18
19 0.19
20 0.25
21 0.32
22 0.39
23 0.48
24 0.56
25 0.61
26 0.69
27 0.78
28 0.81
29 0.84
30 0.87
31 0.88
32 0.88
33 0.81
34 0.77
35 0.68
36 0.66
37 0.57
38 0.5
39 0.39
40 0.3
41 0.28
42 0.29
43 0.36
44 0.35
45 0.4
46 0.4
47 0.41
48 0.4
49 0.4
50 0.36
51 0.28
52 0.23
53 0.16
54 0.16
55 0.14
56 0.14
57 0.12
58 0.11
59 0.11
60 0.11
61 0.12
62 0.13
63 0.14
64 0.15
65 0.16
66 0.15
67 0.14
68 0.14
69 0.13
70 0.1
71 0.08
72 0.07
73 0.06
74 0.06
75 0.05
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.06
87 0.06
88 0.05
89 0.05
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.06
96 0.07
97 0.07
98 0.07
99 0.08
100 0.08
101 0.08
102 0.1
103 0.13
104 0.2
105 0.24
106 0.28
107 0.36
108 0.44
109 0.52