Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067SYE1

Protein Details
Accession A0A067SYE1    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
39-63DRVPKKNWPKGPTRPRKPKLPATLDBasic
NLS Segment(s)
PositionSequence
42-57PKKNWPKGPTRPRKPK
Subcellular Location(s) nucl 21, cyto_nucl 13.833, cyto 4.5
Family & Domain DBs
Amino Acid Sequences RAAKKEAQAKIDEEWKRIKIIHEEAVKVWKAECDKLASDRVPKKNWPKGPTRPRKPKLPATLDDIVDEDDGEEDEEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.37
3 0.36
4 0.35
5 0.35
6 0.33
7 0.35
8 0.39
9 0.37
10 0.36
11 0.35
12 0.39
13 0.36
14 0.29
15 0.24
16 0.19
17 0.18
18 0.18
19 0.18
20 0.16
21 0.17
22 0.19
23 0.22
24 0.21
25 0.26
26 0.32
27 0.36
28 0.36
29 0.42
30 0.49
31 0.54
32 0.6
33 0.57
34 0.58
35 0.64
36 0.72
37 0.77
38 0.78
39 0.81
40 0.79
41 0.85
42 0.83
43 0.82
44 0.81
45 0.78
46 0.7
47 0.66
48 0.66
49 0.56
50 0.49
51 0.4
52 0.31
53 0.23
54 0.2
55 0.13
56 0.08
57 0.08
58 0.08
59 0.07