Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067T6A5

Protein Details
Accession A0A067T6A5   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
23-49CCPAVSNSCSRRRRRHRRSTPSLFFCSHydrophilic
NLS Segment(s)
PositionSequence
34-39RRRRHR
Subcellular Location(s) nucl 13, mito 11, cyto 2
Family & Domain DBs
Amino Acid Sequences MSAQIALSTSPPPALALARSTVCCPAVSNSCSRRRRRHRRSTPSLFFCSYVQLLAPQLQEDMACEPFEVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.11
4 0.13
5 0.14
6 0.15
7 0.16
8 0.16
9 0.16
10 0.15
11 0.14
12 0.15
13 0.18
14 0.19
15 0.24
16 0.29
17 0.39
18 0.46
19 0.52
20 0.6
21 0.66
22 0.76
23 0.81
24 0.85
25 0.87
26 0.9
27 0.93
28 0.93
29 0.91
30 0.86
31 0.79
32 0.69
33 0.59
34 0.49
35 0.42
36 0.31
37 0.22
38 0.16
39 0.12
40 0.12
41 0.14
42 0.14
43 0.11
44 0.11
45 0.11
46 0.11
47 0.11
48 0.13
49 0.11
50 0.11