Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067SRC2

Protein Details
Accession A0A067SRC2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
50-71DLYKCMRRTPMPKKTHKPTINYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MTIHIEKLKVRPRKAAQTVMCAPQLTAMLACWAASQDVMSVGQCKDSAEDLYKCMRRTPMPKKTHKPTINYHLARLGKSIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.7
3 0.64
4 0.64
5 0.64
6 0.58
7 0.53
8 0.42
9 0.35
10 0.27
11 0.24
12 0.16
13 0.12
14 0.08
15 0.07
16 0.07
17 0.07
18 0.05
19 0.05
20 0.05
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.05
27 0.06
28 0.06
29 0.07
30 0.07
31 0.07
32 0.07
33 0.08
34 0.1
35 0.12
36 0.13
37 0.14
38 0.21
39 0.25
40 0.24
41 0.26
42 0.29
43 0.31
44 0.4
45 0.49
46 0.52
47 0.59
48 0.69
49 0.76
50 0.81
51 0.86
52 0.82
53 0.78
54 0.77
55 0.77
56 0.77
57 0.69
58 0.63
59 0.6
60 0.56
61 0.5