Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067T695

Protein Details
Accession A0A067T695    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
48-76AKSRPFKNPWFHHRKRWRRQLCREREVTTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
Amino Acid Sequences MTIAVASSLLHRRCCCRTHCMLLRNSTVYRSSRRFALGTSVLWVAEGAKSRPFKNPWFHHRKRWRRQLCREREVTTATTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.44
3 0.44
4 0.48
5 0.53
6 0.59
7 0.61
8 0.61
9 0.61
10 0.6
11 0.56
12 0.5
13 0.41
14 0.37
15 0.33
16 0.33
17 0.32
18 0.29
19 0.28
20 0.29
21 0.28
22 0.24
23 0.26
24 0.22
25 0.18
26 0.18
27 0.16
28 0.13
29 0.13
30 0.12
31 0.07
32 0.07
33 0.08
34 0.08
35 0.13
36 0.15
37 0.17
38 0.24
39 0.27
40 0.33
41 0.42
42 0.5
43 0.55
44 0.64
45 0.68
46 0.72
47 0.8
48 0.84
49 0.85
50 0.87
51 0.88
52 0.88
53 0.94
54 0.94
55 0.94
56 0.92
57 0.87
58 0.79
59 0.72
60 0.66