Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067SX14

Protein Details
Accession A0A067SX14    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
63-88RGTEYQPSQRKRKRKHGFLARKRSVGBasic
NLS Segment(s)
PositionSequence
72-102RKRKRKHGFLARKRSVGGRRVLSRRLAKGRK
Subcellular Location(s) mito 13, nucl 12.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRIPPSLLATLLRPPPRLPLIDALRHLARPQQQFRSSILRTSIQQPPPLSPLYQLSVRFAARGTEYQPSQRKRKRKHGFLARKRSVGGRRVLSRRLAKGRKYLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.34
4 0.36
5 0.36
6 0.32
7 0.34
8 0.36
9 0.39
10 0.4
11 0.38
12 0.36
13 0.34
14 0.32
15 0.28
16 0.29
17 0.33
18 0.37
19 0.41
20 0.43
21 0.45
22 0.47
23 0.5
24 0.44
25 0.39
26 0.35
27 0.29
28 0.27
29 0.3
30 0.35
31 0.29
32 0.32
33 0.3
34 0.29
35 0.3
36 0.29
37 0.24
38 0.18
39 0.17
40 0.15
41 0.17
42 0.16
43 0.15
44 0.17
45 0.16
46 0.16
47 0.14
48 0.13
49 0.11
50 0.12
51 0.13
52 0.14
53 0.15
54 0.23
55 0.31
56 0.36
57 0.45
58 0.52
59 0.6
60 0.65
61 0.76
62 0.79
63 0.81
64 0.86
65 0.87
66 0.9
67 0.91
68 0.93
69 0.88
70 0.79
71 0.71
72 0.67
73 0.63
74 0.58
75 0.55
76 0.52
77 0.55
78 0.58
79 0.61
80 0.62
81 0.62
82 0.65
83 0.68
84 0.68
85 0.65
86 0.69