Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067SIM6

Protein Details
Accession A0A067SIM6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTPPRPNKRRKIETQIATFLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, cyto_mito 12.333, cyto 11, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR005100  NGN-domain  
IPR036735  NGN_dom_sf  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF03439  Spt5-NGN  
Amino Acid Sequences MTPPRPNKRRKIETQIATFLDIEAGVEADGDVSEEEGEYDQDENIFSHTLLSREYDGAGDIDWDTFLDRARRRGRNGVLTMNAEGPREGPRDSDGLYEIMCQVGTEETAVFRVLQAAVDPALVIYSAFARKSLPGRIFAEVLSLDAAQALAKKVSYLSPHNIRQIPQERMTEMLELGGNTSDTSGTLPLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.79
3 0.7
4 0.62
5 0.52
6 0.41
7 0.31
8 0.22
9 0.15
10 0.08
11 0.07
12 0.05
13 0.04
14 0.04
15 0.04
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.05
23 0.05
24 0.05
25 0.06
26 0.06
27 0.06
28 0.06
29 0.07
30 0.07
31 0.08
32 0.08
33 0.07
34 0.09
35 0.1
36 0.1
37 0.11
38 0.12
39 0.12
40 0.12
41 0.12
42 0.1
43 0.1
44 0.09
45 0.09
46 0.07
47 0.06
48 0.06
49 0.05
50 0.05
51 0.05
52 0.05
53 0.07
54 0.13
55 0.15
56 0.23
57 0.32
58 0.37
59 0.41
60 0.49
61 0.52
62 0.53
63 0.55
64 0.5
65 0.44
66 0.4
67 0.37
68 0.31
69 0.27
70 0.19
71 0.16
72 0.13
73 0.13
74 0.14
75 0.13
76 0.11
77 0.11
78 0.12
79 0.13
80 0.13
81 0.11
82 0.09
83 0.09
84 0.09
85 0.08
86 0.06
87 0.06
88 0.05
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.05
96 0.05
97 0.05
98 0.04
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.04
108 0.04
109 0.04
110 0.03
111 0.03
112 0.05
113 0.06
114 0.07
115 0.07
116 0.08
117 0.1
118 0.14
119 0.2
120 0.2
121 0.24
122 0.27
123 0.29
124 0.29
125 0.26
126 0.25
127 0.18
128 0.17
129 0.12
130 0.1
131 0.07
132 0.07
133 0.07
134 0.05
135 0.06
136 0.07
137 0.07
138 0.07
139 0.07
140 0.08
141 0.11
142 0.16
143 0.2
144 0.27
145 0.35
146 0.4
147 0.47
148 0.49
149 0.47
150 0.52
151 0.55
152 0.54
153 0.51
154 0.49
155 0.43
156 0.43
157 0.43
158 0.35
159 0.26
160 0.21
161 0.17
162 0.13
163 0.13
164 0.11
165 0.1
166 0.09
167 0.09
168 0.08
169 0.07
170 0.09