Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067TBE6

Protein Details
Accession A0A067TBE6    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
174-207KPDTSDAVSKKKKNKNKRKKNKKKGTAEDKGEEEBasic
NLS Segment(s)
PositionSequence
182-198SKKKKNKNKRKKNKKKG
Subcellular Location(s) nucl 21, cyto_nucl 12.833, mito_nucl 12.333, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MASTSTVCHHNYNSLTSSDPLSWTQTEPELPIYLAGVRIPSNGFEELIGYVRSLVKQQLPTSNLVPTTYEESRAYLGQQGGKFDPLREMCLVIAVDIPKNQEILMMTSALGICQKLESGSNMFVATMLLPPNAFGSPEDRTCSALVNTTTSKPVQANEVRILTAYFTKKRDATKPDTSDAVSKKKKNKNKRKKNKKKGTAEDKGEEEVGEEREEEETVSDVANS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.27
4 0.28
5 0.22
6 0.23
7 0.2
8 0.21
9 0.21
10 0.2
11 0.21
12 0.21
13 0.21
14 0.2
15 0.21
16 0.18
17 0.17
18 0.15
19 0.14
20 0.12
21 0.11
22 0.1
23 0.09
24 0.09
25 0.1
26 0.1
27 0.11
28 0.13
29 0.13
30 0.13
31 0.11
32 0.12
33 0.12
34 0.13
35 0.12
36 0.09
37 0.09
38 0.1
39 0.1
40 0.11
41 0.13
42 0.16
43 0.2
44 0.23
45 0.28
46 0.3
47 0.32
48 0.32
49 0.32
50 0.27
51 0.24
52 0.22
53 0.17
54 0.21
55 0.18
56 0.2
57 0.18
58 0.18
59 0.19
60 0.18
61 0.17
62 0.15
63 0.16
64 0.17
65 0.18
66 0.19
67 0.18
68 0.21
69 0.21
70 0.18
71 0.22
72 0.18
73 0.2
74 0.18
75 0.18
76 0.15
77 0.16
78 0.16
79 0.1
80 0.11
81 0.08
82 0.09
83 0.09
84 0.1
85 0.08
86 0.09
87 0.08
88 0.08
89 0.08
90 0.09
91 0.09
92 0.08
93 0.08
94 0.08
95 0.08
96 0.07
97 0.07
98 0.05
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.06
105 0.07
106 0.08
107 0.09
108 0.09
109 0.08
110 0.08
111 0.08
112 0.07
113 0.06
114 0.06
115 0.05
116 0.05
117 0.05
118 0.07
119 0.07
120 0.07
121 0.06
122 0.09
123 0.12
124 0.13
125 0.15
126 0.15
127 0.16
128 0.16
129 0.18
130 0.15
131 0.16
132 0.15
133 0.16
134 0.17
135 0.17
136 0.19
137 0.17
138 0.19
139 0.16
140 0.16
141 0.2
142 0.22
143 0.25
144 0.27
145 0.28
146 0.26
147 0.25
148 0.25
149 0.18
150 0.2
151 0.21
152 0.22
153 0.23
154 0.27
155 0.3
156 0.35
157 0.42
158 0.45
159 0.47
160 0.53
161 0.56
162 0.55
163 0.54
164 0.5
165 0.49
166 0.46
167 0.49
168 0.47
169 0.49
170 0.57
171 0.65
172 0.74
173 0.78
174 0.84
175 0.86
176 0.89
177 0.93
178 0.95
179 0.96
180 0.98
181 0.98
182 0.97
183 0.97
184 0.96
185 0.95
186 0.94
187 0.9
188 0.84
189 0.76
190 0.67
191 0.56
192 0.45
193 0.35
194 0.28
195 0.22
196 0.17
197 0.14
198 0.13
199 0.13
200 0.14
201 0.12
202 0.1
203 0.1
204 0.1