Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6QHA3

Protein Details
Accession B6QHA3    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
57-82QDDINKAYRKKSKQLHPDKVKRSFIAHydrophilic
242-261AMNRRQKRMMERENRKESKKBasic
NLS Segment(s)
PositionSequence
65-99RKKSKQLHPDKVKRSFIANSARGDGKKKGKKPGVH
247-263QKRMMERENRKESKKGN
399-409TRKRGKRGQKK
Subcellular Location(s) plas 7, E.R. 6, extr 5, vacu 3, nucl 2, mito 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
Gene Ontology GO:0016020  C:membrane  
KEGG tmf:PMAA_093640  -  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MRHSAFQFLVVAILFVFVAAWTKEDHEIFQIRDELIAKEGPNVTFYDFLGVAPNANQDDINKAYRKKSKQLHPDKVKRSFIANSARGDGKKKGKKPGVHVSKGPSERQIANAVKEATERSARLNTVANILRGPSRERYDHFMKHGFPTWKGTGYYYSRFRPGLGSVLLGLFVVFGGFGHYIALVLSYRRQREFMDRYIRHARKAAWGDERAFGGIPGLDATATATPAAAPQAEAEESPAAMAMNRRQKRMMERENRKESKKGNKNSSPSGSGSGTATPISENVASVSGPKKRVYAENGKILVVDSAGNVFLEEETEDGEKQEFLLDVDEIPRPAFRDTYVARLPCWLYRRVLRKKDEEEEPSDALEGADDVDTNDVDILAETEVTKSTSSKGSAATAATRKRGKRGQKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.05
3 0.05
4 0.04
5 0.07
6 0.07
7 0.08
8 0.08
9 0.11
10 0.16
11 0.17
12 0.18
13 0.22
14 0.26
15 0.26
16 0.29
17 0.3
18 0.25
19 0.27
20 0.27
21 0.22
22 0.2
23 0.22
24 0.18
25 0.2
26 0.23
27 0.21
28 0.21
29 0.21
30 0.2
31 0.19
32 0.19
33 0.18
34 0.15
35 0.14
36 0.17
37 0.16
38 0.15
39 0.14
40 0.17
41 0.14
42 0.15
43 0.15
44 0.11
45 0.16
46 0.19
47 0.25
48 0.27
49 0.3
50 0.38
51 0.47
52 0.54
53 0.58
54 0.64
55 0.68
56 0.74
57 0.82
58 0.84
59 0.86
60 0.9
61 0.9
62 0.89
63 0.85
64 0.75
65 0.69
66 0.61
67 0.57
68 0.57
69 0.52
70 0.45
71 0.43
72 0.45
73 0.42
74 0.43
75 0.43
76 0.44
77 0.48
78 0.52
79 0.59
80 0.63
81 0.68
82 0.72
83 0.76
84 0.76
85 0.72
86 0.7
87 0.65
88 0.65
89 0.63
90 0.56
91 0.49
92 0.42
93 0.38
94 0.36
95 0.39
96 0.33
97 0.31
98 0.34
99 0.31
100 0.27
101 0.27
102 0.25
103 0.2
104 0.2
105 0.19
106 0.17
107 0.2
108 0.2
109 0.21
110 0.23
111 0.21
112 0.24
113 0.26
114 0.23
115 0.2
116 0.2
117 0.21
118 0.19
119 0.21
120 0.2
121 0.22
122 0.25
123 0.27
124 0.33
125 0.38
126 0.4
127 0.42
128 0.41
129 0.39
130 0.38
131 0.43
132 0.39
133 0.33
134 0.35
135 0.33
136 0.31
137 0.3
138 0.28
139 0.27
140 0.29
141 0.33
142 0.32
143 0.32
144 0.33
145 0.32
146 0.32
147 0.28
148 0.24
149 0.22
150 0.17
151 0.16
152 0.13
153 0.12
154 0.12
155 0.09
156 0.08
157 0.04
158 0.03
159 0.03
160 0.02
161 0.02
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.04
169 0.05
170 0.04
171 0.04
172 0.08
173 0.13
174 0.15
175 0.16
176 0.18
177 0.19
178 0.27
179 0.32
180 0.36
181 0.42
182 0.4
183 0.46
184 0.55
185 0.55
186 0.48
187 0.46
188 0.39
189 0.36
190 0.39
191 0.37
192 0.32
193 0.33
194 0.33
195 0.31
196 0.3
197 0.23
198 0.19
199 0.15
200 0.09
201 0.07
202 0.05
203 0.04
204 0.04
205 0.03
206 0.03
207 0.04
208 0.04
209 0.04
210 0.04
211 0.04
212 0.04
213 0.04
214 0.05
215 0.04
216 0.04
217 0.04
218 0.05
219 0.05
220 0.05
221 0.06
222 0.06
223 0.06
224 0.06
225 0.06
226 0.04
227 0.05
228 0.07
229 0.12
230 0.21
231 0.24
232 0.26
233 0.28
234 0.31
235 0.4
236 0.48
237 0.53
238 0.54
239 0.62
240 0.71
241 0.8
242 0.82
243 0.76
244 0.72
245 0.69
246 0.69
247 0.69
248 0.68
249 0.67
250 0.7
251 0.72
252 0.72
253 0.69
254 0.61
255 0.53
256 0.47
257 0.38
258 0.3
259 0.26
260 0.2
261 0.17
262 0.13
263 0.12
264 0.08
265 0.08
266 0.09
267 0.08
268 0.07
269 0.07
270 0.08
271 0.07
272 0.1
273 0.14
274 0.17
275 0.2
276 0.2
277 0.22
278 0.24
279 0.29
280 0.35
281 0.41
282 0.42
283 0.48
284 0.48
285 0.46
286 0.44
287 0.39
288 0.31
289 0.21
290 0.15
291 0.07
292 0.06
293 0.06
294 0.06
295 0.06
296 0.06
297 0.05
298 0.05
299 0.05
300 0.05
301 0.06
302 0.07
303 0.08
304 0.08
305 0.09
306 0.08
307 0.08
308 0.09
309 0.08
310 0.07
311 0.09
312 0.08
313 0.08
314 0.1
315 0.12
316 0.11
317 0.11
318 0.12
319 0.12
320 0.14
321 0.14
322 0.13
323 0.19
324 0.2
325 0.28
326 0.33
327 0.32
328 0.31
329 0.35
330 0.36
331 0.33
332 0.36
333 0.31
334 0.3
335 0.38
336 0.48
337 0.54
338 0.62
339 0.64
340 0.7
341 0.74
342 0.76
343 0.76
344 0.72
345 0.67
346 0.63
347 0.56
348 0.47
349 0.4
350 0.33
351 0.24
352 0.18
353 0.12
354 0.07
355 0.06
356 0.06
357 0.06
358 0.07
359 0.07
360 0.07
361 0.07
362 0.06
363 0.06
364 0.06
365 0.07
366 0.06
367 0.06
368 0.06
369 0.07
370 0.08
371 0.09
372 0.1
373 0.1
374 0.13
375 0.17
376 0.19
377 0.21
378 0.22
379 0.23
380 0.25
381 0.26
382 0.31
383 0.34
384 0.37
385 0.43
386 0.49
387 0.5
388 0.57
389 0.64