Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067T687

Protein Details
Accession A0A067T687    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
182-201PEELERRKKRAERFGLANKABasic
NLS Segment(s)
PositionSequence
187-194RRKKRAER
Subcellular Location(s) nucl 12, cyto 10, mito 5, cyto_pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036361  SAP_dom_sf  
IPR040746  THO1_MOS11_C  
Pfam View protein in Pfam  
PF18592  Tho1_MOS11_C  
Amino Acid Sequences MDAKLKALKVVDLKQILAKAHVVVPAKATKNDLIARIQASKPALDVYAALYPQDDLLAPPEEVDWNVDQLDSPPQEKHKPAPSTSDPAPPPPAPAATPAAPIPVSAPTAAAADDELEKKRQRAARFGIPFVEPQQKRAKPIVPGVDPKKLEERAARFGIPAVPPTATNGKKRAAPHAAEVDPEELERRKKRAERFGLANKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.34
4 0.3
5 0.26
6 0.2
7 0.2
8 0.23
9 0.22
10 0.19
11 0.22
12 0.28
13 0.29
14 0.29
15 0.3
16 0.27
17 0.31
18 0.33
19 0.32
20 0.28
21 0.28
22 0.29
23 0.31
24 0.29
25 0.27
26 0.25
27 0.23
28 0.21
29 0.19
30 0.16
31 0.12
32 0.12
33 0.1
34 0.12
35 0.12
36 0.11
37 0.1
38 0.1
39 0.1
40 0.1
41 0.07
42 0.05
43 0.08
44 0.09
45 0.09
46 0.09
47 0.1
48 0.1
49 0.1
50 0.12
51 0.09
52 0.08
53 0.08
54 0.08
55 0.08
56 0.08
57 0.13
58 0.12
59 0.13
60 0.14
61 0.18
62 0.23
63 0.25
64 0.29
65 0.33
66 0.36
67 0.36
68 0.41
69 0.41
70 0.42
71 0.42
72 0.44
73 0.35
74 0.34
75 0.37
76 0.29
77 0.27
78 0.23
79 0.22
80 0.15
81 0.17
82 0.17
83 0.13
84 0.14
85 0.12
86 0.12
87 0.11
88 0.11
89 0.09
90 0.08
91 0.08
92 0.06
93 0.07
94 0.06
95 0.06
96 0.06
97 0.06
98 0.05
99 0.05
100 0.06
101 0.07
102 0.08
103 0.12
104 0.13
105 0.13
106 0.19
107 0.23
108 0.25
109 0.31
110 0.36
111 0.42
112 0.44
113 0.44
114 0.41
115 0.37
116 0.36
117 0.32
118 0.36
119 0.26
120 0.27
121 0.36
122 0.36
123 0.39
124 0.43
125 0.43
126 0.37
127 0.44
128 0.47
129 0.41
130 0.48
131 0.48
132 0.51
133 0.48
134 0.46
135 0.46
136 0.4
137 0.39
138 0.38
139 0.39
140 0.38
141 0.41
142 0.39
143 0.32
144 0.32
145 0.32
146 0.26
147 0.22
148 0.17
149 0.15
150 0.15
151 0.19
152 0.26
153 0.27
154 0.31
155 0.34
156 0.35
157 0.4
158 0.42
159 0.47
160 0.46
161 0.44
162 0.45
163 0.48
164 0.46
165 0.42
166 0.42
167 0.34
168 0.27
169 0.25
170 0.23
171 0.19
172 0.27
173 0.32
174 0.35
175 0.43
176 0.5
177 0.59
178 0.66
179 0.72
180 0.72
181 0.75