Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067SV69

Protein Details
Accession A0A067SV69    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
35-68DTRDKNKSSQRLRRSTRPGRWYPRQRRRSMEHGAHydrophilic
NLS Segment(s)
PositionSequence
45-62RLRRSTRPGRWYPRQRRR
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MTEMRYGKPIPDDAIAELRNPALKSYYDMNDEEDDTRDKNKSSQRLRRSTRPGRWYPRQRRRSMEHGAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.22
4 0.2
5 0.18
6 0.19
7 0.18
8 0.16
9 0.12
10 0.12
11 0.14
12 0.18
13 0.19
14 0.19
15 0.19
16 0.21
17 0.2
18 0.2
19 0.19
20 0.16
21 0.15
22 0.13
23 0.14
24 0.13
25 0.12
26 0.17
27 0.23
28 0.31
29 0.4
30 0.49
31 0.57
32 0.66
33 0.72
34 0.77
35 0.81
36 0.82
37 0.81
38 0.81
39 0.81
40 0.81
41 0.85
42 0.87
43 0.88
44 0.88
45 0.89
46 0.87
47 0.85
48 0.83
49 0.81