Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067SN58

Protein Details
Accession A0A067SN58   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
46-70KSGSSHRQWKSRRLARKLRRFRSDGBasic
NLS Segment(s)
PositionSequence
53-67QWKSRRLARKLRRFR
Subcellular Location(s) nucl 12, mito 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MATHEPLLLCAILRNIEVVGNVQSGKWRARSSYSAQIYVADKETMKSGSSHRQWKSRRLARKLRRFRSDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.09
5 0.09
6 0.09
7 0.09
8 0.09
9 0.08
10 0.11
11 0.13
12 0.15
13 0.17
14 0.17
15 0.17
16 0.21
17 0.25
18 0.28
19 0.35
20 0.35
21 0.32
22 0.31
23 0.32
24 0.29
25 0.26
26 0.22
27 0.13
28 0.11
29 0.11
30 0.12
31 0.11
32 0.11
33 0.11
34 0.13
35 0.22
36 0.29
37 0.38
38 0.41
39 0.49
40 0.54
41 0.62
42 0.69
43 0.69
44 0.72
45 0.74
46 0.8
47 0.82
48 0.89
49 0.9
50 0.89