Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067T5X2

Protein Details
Accession A0A067T5X2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
49-74FREAYRKVKRSHIRRRHLSRRSGGASBasic
NLS Segment(s)
PositionSequence
52-69AYRKVKRSHIRRRHLSRR
Subcellular Location(s) cyto 7, plas 6, extr 6, cyto_mito 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRPESEDLGPRSSPVTRPSLLAWPSVTPISGVGYLLVVLLIRKHVAPGFREAYRKVKRSHIRRRHLSRRSGGASLETQDIILI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.24
4 0.26
5 0.27
6 0.32
7 0.31
8 0.29
9 0.26
10 0.21
11 0.22
12 0.21
13 0.18
14 0.11
15 0.1
16 0.1
17 0.09
18 0.08
19 0.06
20 0.06
21 0.06
22 0.05
23 0.05
24 0.03
25 0.03
26 0.03
27 0.03
28 0.04
29 0.04
30 0.05
31 0.06
32 0.09
33 0.1
34 0.15
35 0.19
36 0.21
37 0.24
38 0.26
39 0.34
40 0.4
41 0.43
42 0.41
43 0.48
44 0.55
45 0.64
46 0.72
47 0.73
48 0.76
49 0.82
50 0.89
51 0.9
52 0.89
53 0.88
54 0.83
55 0.81
56 0.75
57 0.67
58 0.57
59 0.5
60 0.44
61 0.37
62 0.32
63 0.23